Result : Q8XXX1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | FAD assembly factor SdhE |
| NCBI Accession ID | AL646052.1 |
| Organism | Ralstonia solanacearum (strain GMI1000) (Pseudomonas solanacearum) |
| Left | 2169743 |
| Right | 2170030 |
| Strand | - |
| Nucleotide Sequence | ATGACCGCCGTGAACACTTCGACGTTTTCCCACCAGTCCGATCCGCACAGGCGCGCGCGCCTGCGCTGGCGTGCCCGACGCGGCCTGCTGGAGAACGACATCATCGTCGAGCGTTTTTTCAACCGCTACGAGACCGAGCTGTCCGATGACGACGTCGGCGCGCTCACGCAGTTGTTCGAGTTGCCGGACAACGATCTGATGGATCTCCTGCTGGCCCGCAAGGAGCCCGAAGGAGCGCTCGACGTGCCTTCCGTTCGGCATGTGCTGAGCTTGTTGCGCGCCGTCTAG |
| Sequence | MTAVNTSTFSHQSDPHRRARLRWRARRGLLENDIIVERFFNRYETELSDDDVGALTQLFELPDNDLMDLLLARKEPEGALDVPSVRHVLSLLRAV |
| Source of smORF | Swiss-Prot |
| Function | An FAD assembly protein, which accelerates covalent attachment of the cofactor into other proteins. Plays an essential role in the assembly of succinate dehydrogenase (SDH, respiratory complex II), an enzyme complex that is a component of both the tricarboxylic acid cycle and the electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Required for flavinylation (covalent attachment of FAD) of the flavoprotein subunit SdhA of SDH and other flavinylated proteins as well. {ECO:0000250|UniProtKB:G4V4G2}. |
| Pubmed ID | 11823852 |
| Domain | CDD:412748 |
| Functional Category | Others |
| Uniprot ID | Q8XXX1 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 87
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 586865 | 587152 | - | NZ_CP012943.1 | Ralstonia solanacearum |
| 2 | 1042771 | 1043058 | - | NZ_CP068286.1 | Ralstonia syzygii subsp. celebesensis |
| 3 | 481033 | 481320 | - | NZ_CP011257.1 | Ralstonia mannitolilytica |
| 4 | 1149621 | 1149908 | + | NZ_CP016022.1 | Ralstonia insidiosa |
| 5 | 918294 | 918563 | - | NZ_CP015960.1 | Paraburkholderia caribensis |
| 6 | 1232873 | 1233142 | - | NZ_CP015959.1 | Paraburkholderia caribensis |
| 7 | 2562839 | 2563126 | - | NZ_CP032519.1 | Cupriavidus oxalaticus |
| 8 | 3062225 | 3062512 | - | NZ_CP062803.1 | Cupriavidus basilensis |
| 9 | 2838158 | 2838445 | - | NZ_CP039287.1 | Cupriavidus necator H16 |
| 10 | 889194 | 889460 | - | NZ_CP046914.1 | Paraburkholderia acidisoli |
| 11 | 1622316 | 1622582 | + | NZ_CP049135.1 | Paraburkholderia tropica |
| 12 | 2189733 | 2190017 | - | NZ_CP054626.1 | Cupriavidus gilardii |
| 13 | 1756348 | 1756614 | - | NZ_CP046910.1 | Paraburkholderia acidiphila |
| 14 | 3508025 | 3508312 | - | NZ_CP017754.1 | Cupriavidus malaysiensis |
| 15 | 3018685 | 3018957 | - | NZ_CP011568.3 | Pandoraea thiooxydans |
| 16 | 2462349 | 2462621 | - | NC_007511.1 | Burkholderia lata |
| 17 | 894382 | 894654 | + | NZ_CP013416.1 | Burkholderia ubonensis |
| 18 | 1891830 | 1892102 | + | NZ_CP011807.3 | Pandoraea faecigallinarum |
| 19 | 857107 | 857379 | + | NZ_CP013461.1 | Burkholderia stagnalis |
| 20 | 128541 | 128813 | - | NZ_CP011504.1 | Burkholderia pyrrocinia |
| 21 | 959927 | 960199 | + | NZ_CP013400.1 | Burkholderia seminalis |
| 22 | 2013826 | 2014098 | + | NZ_CP011253.3 | Pandoraea oxalativorans |
| 23 | 2239000 | 2239272 | + | NZ_CP010310.2 | Pandoraea pulmonicola |
| 24 | 909903 | 910175 | + | NZ_CP013403.1 | Burkholderia metallica |
| 25 | 3369426 | 3369698 | - | NZ_LT906435.1 | Pandoraea sputorum |
| 26 | 818237 | 818509 | + | NZ_CP009831.1 | Burkholderia multivorans ATCC BAA-247 |
| 27 | 2289536 | 2289808 | + | NZ_CP013481.2 | Pandoraea apista |
| 28 | 2063073 | 2063345 | + | NZ_CP010897.2 | Pandoraea vervacti |
| 29 | 1010706 | 1010975 | + | NZ_CP013452.1 | Burkholderia cenocepacia |
| 30 | 2012171 | 2012443 | + | NC_023018.2 | Pandoraea pnomenusa |
| 31 | 4149324 | 4149596 | - | NZ_CP047385.1 | Pandoraea fibrosis |
| 32 | 1633216 | 1633488 | - | NZ_CP045236.1 | Burkholderia cepacia |
| 33 | 3723531 | 3723803 | - | NZ_CP013480.3 | Pandoraea norimbergensis |
| 34 | 2339025 | 2339297 | - | NZ_CP002581.1 | Burkholderia plantarii |
| 35 | 207596 | 207868 | - | NZ_CP035901.1 | Burkholderia glumae |
| 36 | 1122817 | 1123089 | + | NZ_CP020738.1 | Paraburkholderia acidophila |
| 37 | 2789747 | 2790019 | + | NZ_CP024935.1 | Paraburkholderia graminis |
| 38 | 3127464 | 3127739 | - | NZ_CP031466.1 | Paraburkholderia caffeinilytica |
| 39 | 1547357 | 1547629 | - | NZ_CP009793.1 | Burkholderia dolosa AU0158 |
| 40 | 1049923 | 1050195 | - | NZ_CP017562.1 | Paraburkholderia sprentiae WSM5005 |
| 41 | 4858020 | 4858286 | - | NZ_CP023422.1 | Janthinobacterium svalbardensis |
| 42 | 4945935 | 4946201 | - | NZ_CP048832.1 | Janthinobacterium lividum |
| 43 | 1284681 | 1284953 | + | NZ_CP024942.1 | Paraburkholderia terricola |
| 44 | 2130497 | 2130769 | + | NZ_CP022990.1 | Paraburkholderia aromaticivorans |
| 45 | 158838 | 159110 | + | NC_007952.1 | Paraburkholderia xenovorans LB400 |
| 46 | 2541410 | 2541676 | - | NZ_CP041185.1 | Janthinobacterium tructae |
| 47 | 92237 | 92509 | + | NZ_CP066076.1 | Paraburkholderia ginsengisoli |
| 48 | 1391644 | 1391916 | + | NC_010623.1 | Paraburkholderia phymatum STM815 |
| 49 | 1235154 | 1235426 | + | NZ_CP009556.1 | Burkholderia oklahomensis C6786 |
| 50 | 55431 | 55703 | + | NC_010625.1 | Paraburkholderia phymatum STM815 |
| 51 | 3203786 | 3204058 | - | NC_010676.1 | Paraburkholderia phytofirmans PsJN |
| 52 | 2048229 | 2048498 | - | NC_014722.1 | Mycetohabitans rhizoxinica HKI 454 |
| 53 | 2402017 | 2402286 | - | NZ_CP026113.1 | Paraburkholderia terrae |
| 54 | 776390 | 776662 | + | NC_007650.1 | Burkholderia thailandensis E264 |
| 55 | 325877 | 326149 | + | NZ_CP008782.1 | Burkholderia pseudomallei |
| 56 | 2755919 | 2756188 | - | NZ_CP026112.1 | Paraburkholderia terrae |
| 57 | 1325346 | 1325630 | - | NC_021294.1 | Caballeronia insecticola |
| 58 | 1655406 | 1655678 | - | NZ_CP009728.1 | Burkholderia mallei |
| 59 | 3113293 | 3113574 | - | NZ_CP040017.1 | Massilia umbonata |
| 60 | 5051035 | 5051301 | - | NZ_CP047650.1 | Xylophilus rhododendri |
| 61 | 2135779 | 2136069 | - | NZ_CP043575.1 | Comamonas koreensis |
| 62 | 3810256 | 3810516 | - | NZ_HG322949.1 | Janthinobacterium agaricidamnosum NBRC 102515 = DSM 9628 |
| 63 | 3487064 | 3487348 | - | NZ_CP013737.1 | Herbaspirillum rubrisubalbicans M1 |
| 64 | 1949287 | 1949580 | - | NZ_CP046904.1 | Massilia flava |
| 65 | 2191549 | 2191815 | - | NZ_CP019038.1 | Massilia putida |
| 66 | 2690851 | 2691120 | - | NZ_CP013235.1 | Collimonas arenae |
| 67 | 3385560 | 3385832 | - | NZ_CP011930.1 | Herbaspirillum seropedicae |
| 68 | 3192823 | 3193092 | - | NZ_CP013236.1 | Collimonas pratensis |
| 69 | 1382199 | 1382480 | + | NZ_CP036401.1 | Massilia albidiflava |
| 70 | 2342829 | 2343107 | + | NZ_CP013232.1 | Collimonas fungivorans |
| 71 | 3408155 | 3408427 | - | NZ_CP037993.1 | Herbaspirillum huttiense |
| 72 | 3066631 | 3066888 | + | NZ_CP021455.1 | Comamonas serinivorans |
| 73 | 3808778 | 3809044 | + | NZ_CP024608.1 | Massilia violaceinigra |
| 74 | 4238737 | 4239003 | + | NZ_CP034464.1 | Undibacterium parvum |
| 75 | 4901368 | 4901649 | - | NZ_CP028324.1 | Massilia armeniaca |
| 76 | 355726 | 355995 | + | NZ_CP018845.1 | Herbaspirillum robiniae |
| 77 | 2251789 | 2252031 | - | NZ_AP018150.1 | Mycoavidus cysteinexigens |
| 78 | 2627383 | 2627661 | + | NZ_CP024645.1 | Rhizobacter gummiphilus |
| 79 | 3125230 | 3125499 | - | NZ_CP022423.1 | Vitreoscilla filiformis |
| 80 | 1003665 | 1003928 | - | NZ_CP051461.1 | Polaromonas vacuolata |
| 81 | 1812526 | 1812819 | + | NZ_CP060790.1 | Acidovorax monticola |
| 82 | 3631772 | 3632032 | + | NZ_CP017476.1 | Hydrogenophaga crassostreae |
| 83 | 3246511 | 3246789 | - | NZ_CP013729.1 | Roseateles depolymerans |
| 84 | 2973669 | 2973944 | - | NC_010524.1 | Leptothrix cholodnii SP-6 |
| 85 | 2324419 | 2324664 | - | NC_008825.1 | Methylibium petroleiphilum PM1 |
| 86 | 1865481 | 1865711 | - | NZ_CP031124.1 | Ephemeroptericola cinctiostellae |
| 87 | 898000 | 898269 | - | NZ_LT671418.1 | Herminiimonas arsenitoxidans |
| 88 | 1406763 | 1407011 | - | NZ_CP037867.1 | Hydrogenophaga pseudoflava |
| 89 | 2031748 | 2031999 | - | NZ_CP028901.1 | Algicoccus marinus |
| 90 | 2730877 | 2731137 | - | NZ_CP029210.1 | Aquabacterium olei |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP012943.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00285.23 | 0.99 | 86 | 65.5 | same-strand | Citrate synthase, C-terminal domain |
| 2 | PF13085.8 | 0.99 | 86 | 16 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 3 | PF13183.8 | 0.99 | 86 | 16 | same-strand | 4Fe-4S dicluster domain |
| 4 | PF13534.8 | 0.99 | 86 | 16 | same-strand | 4Fe-4S dicluster domain |
| 5 | PF13237.8 | 0.99 | 86 | 16 | same-strand | 4Fe-4S dicluster domain |
| 6 | PF13187.8 | 0.91 | 79 | 13.5 | same-strand | 4Fe-4S dicluster domain |
| 7 | PF12838.9 | 0.76 | 66 | 12 | same-strand | 4Fe-4S dicluster domain |
| 8 | PF00890.26 | 0.98 | 85 | 746.0 | same-strand | FAD binding domain |
| 9 | PF02910.22 | 0.99 | 86 | 746 | same-strand | Fumarate reductase flavoprotein C-term |
| 10 | PF01127.24 | 0.99 | 86 | 2803.0 | same-strand | Succinate dehydrogenase/Fumarate reductase transmembrane subunit |
| 11 | PF07702.15 | 0.93 | 81 | 3511 | same-strand | UTRA domain |
| 12 | PF00392.23 | 0.93 | 81 | 3518.5 | same-strand | Bacterial regulatory proteins, gntR family |
++ More..