Result : Q8XRG1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Probable tautomerase RSp0893 (EC 5.3.2.-) |
| NCBI Accession ID | AL646053.1 |
| Organism | Ralstonia solanacearum (strain GMI1000) (Pseudomonas solanacearum) |
| Left | 1130150 |
| Right | 1130362 |
| Strand | + |
| Nucleotide Sequence | ATGCCATTGATCCAGGTCACGCTGATCGAAGGACGCACGATGGAAGCCAAGGCCGCGCTGATCGGCAGCCTGACGCAGGCCGCGGTGGCCACGCTGGGCGCGCCGCGCGAGTCGGTGCGCGTGATCATCCAGGAAGTGCCGGCCGCGCACTGGGGCGTGGCCGGCGTACCGAAATCAGCCGCGAAGGAGCCGCCGCGTGACTCGAAAGCTTAA |
| Sequence | MPLIQVTLIEGRTMEAKAALIGSLTQAAVATLGAPRESVRVIIQEVPAAHWGVAGVPKSAAKEPPRDSKA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00235. Profile Description: N/A. This family includes the enzyme 4-oxalocrotonate tautomerase, which catalyzes the ketonisation of 2-hydroxymuconate to 2-oxo-3-hexenedioate. |
| Pubmed ID | 11823852 |
| Domain | CDD:412246 |
| Functional Category | Others |
| Uniprot ID | Q8XRG1 |
| ORF Length (Amino Acid) | 70 |
++ More..
| Conservation Analysis |
No. of Species: 27
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1689114 | 1689323 | - | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 2 | 2190822 | 2191013 | - | NZ_CP017755.1 | Cupriavidus malaysiensis |
| 3 | 2335140 | 2335331 | + | NZ_CP022196.1 | Celeribacter ethanolicus |
| 4 | 3026831 | 3027031 | + | NZ_CP004387.1 | Alcanivorax pacificus W11-5 |
| 5 | 922005 | 922184 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 6 | 515133 | 515318 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 7 | 4154897 | 4155082 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 8 | 2914658 | 2914867 | + | NZ_CP011310.1 | Aurantiacibacter atlanticus |
| 9 | 2423431 | 2423622 | - | NC_008825.1 | Methylibium petroleiphilum PM1 |
| 10 | 2762276 | 2762467 | - | NZ_CP016210.1 | Azoarcus olearius |
| 11 | 238107 | 238298 | + | NZ_CP021359.1 | Acidovorax carolinensis |
| 12 | 2254389 | 2254580 | + | NZ_CP064338.1 | Schlegelella thermodepolymerans |
| 13 | 386748 | 386939 | + | NZ_CP014646.1 | Thauera humireducens |
| 14 | 2987838 | 2988029 | - | NZ_CP060790.1 | Acidovorax monticola |
| 15 | 929967 | 930152 | + | NZ_CP038012.1 | Sporosarcina pasteurii |
| 16 | 2657443 | 2657634 | - | NZ_CP047241.1 | Aquitalea denitrificans |
| 17 | 3944636 | 3944827 | + | NZ_CP017476.1 | Hydrogenophaga crassostreae |
| 18 | 1804925 | 1805116 | + | NC_016147.2 | Pseudoxanthomonas spadix BD-a59 |
| 19 | 2933141 | 2933332 | + | NZ_CP027669.1 | Simplicispira suum |
| 20 | 2593054 | 2593245 | + | NZ_CP060714.1 | Diaphorobacter ruginosibacter |
| 21 | 325148 | 325339 | + | NZ_CP051298.1 | Alicycliphilus denitrificans |
| 22 | 4598278 | 4598472 | + | NZ_AP022590.1 | Mycobacterium mantenii |
| 23 | 7315062 | 7315262 | - | NZ_AP022871.1 | Phytohabitans suffuscus |
| 24 | 1181361 | 1181567 | + | NC_014006.1 | Sphingobium japonicum UT26S |
| 25 | 999940 | 1000131 | + | NZ_CP030944.1 | Arcobacter aquimarinus |
| 26 | 1022691 | 1022894 | - | NZ_CP060036.1 | Sphingobium fuliginis |
| 27 | 248086 | 248292 | + | NC_013441.1 | Gordonia bronchialis DSM 43247 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_013205.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00682.21 | 0.74 | 20 | 807.5 | same-strand | HMGL-like |
| 2 | PF07836.13 | 0.74 | 20 | 807.5 | same-strand | DmpG-like communication domain |
| 3 | PF09290.13 | 0.74 | 20 | 1830.5 | same-strand | Prokaryotic acetaldehyde dehydrogenase, dimerisation |
| 4 | PF01118.26 | 0.7 | 19 | 1827 | same-strand | Semialdehyde dehydrogenase, NAD binding domain |
++ More..