Protein Information |
Information Type | Description |
---|---|
Protein name | Probable tautomerase RSp1151 (EC 5.3.2.-) |
NCBI Accession ID | AL646053.1 |
Organism | Ralstonia solanacearum (strain GMI1000) (Pseudomonas solanacearum) |
Left | 1451126 |
Right | 1451323 |
Strand | + |
Nucleotide Sequence | ATGCCAGTCGTTCGCGTGAGTTGGTTCGAAGGCAAGGATGCGAAAGCCAAGAAGGCCGTCGCCGCCGAGATCACCGACAGCATCGTCAAGCATGCGGGCACCGACCCCAAATACATCTACGTCATCTTCGAGGACATCAAACCATCCGACTGGGCTGGCGCCGGTCGGCTGTACGGCGAGGAACCCGGAACACCCTGA |
Sequence | MPVVRVSWFEGKDAKAKKAVAAEITDSIVKHAGTDPKYIYVIFEDIKPSDWAGAGRLYGEEPGTP |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00235. Profile Description: N/A. This family includes the enzyme 4-oxalocrotonate tautomerase, which catalyzes the ketonisation of 2-hydroxymuconate to 2-oxo-3-hexenedioate. |
Pubmed ID | 11823852 |
Domain | CDD:412246 |
Functional Category | Others |
Uniprot ID | Q8XQR9 |
ORF Length (Amino Acid) | 65 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2081049 | 2081246 | + | NZ_CP009365.1 | Pseudomonas soli |
2 | 525847 | 526029 | + | NC_011146.1 | Citrifermentans bemidjiense Bem |
3 | 891261 | 891464 | + | NC_010524.1 | Leptothrix cholodnii SP-6 |
4 | 3453831 | 3454028 | - | NZ_CP049044.1 | Pseudomonas psychrophila |
5 | 2824912 | 2825109 | - | NZ_CP023272.1 | Pseudomonas lurida |
6 | 1155121 | 1155300 | + | NZ_CP072611.1 | Aureimonas populi |
7 | 2408894 | 2409091 | - | NZ_CP054301.1 | Marinomonas primoryensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03466.22 | 0.86 | 6 | 314 | opposite-strand | LysR substrate binding domain |
2 | PF00126.29 | 0.86 | 6 | 609.5 | both-strands | Bacterial regulatory helix-turn-helix protein, lysR family |