| Protein name |
50S ribosomal protein L28 |
| NCBI Accession ID |
BA000016.3 |
| Organism |
Clostridium perfringens (strain 13 / Type A) |
| Left |
2011513 |
| Right |
2011767 |
| Strand |
+ |
| Nucleotide Sequence |
ATGGCAAGAAGATGCGAGATTTGTAACAAAGGAGTTGTAGCTGGAGTACAATACAGTCACTCTCACAGACAATCAAAGAGAACTTGGGCTCCTAACATAAAAAAGGTTAAAGCAATCGTTAAAGGAACACCAAAAACTGTTCACGTTTGTACAAGATGCTTAAGATCGGAAAAGTTCAAAGAGCTATATAAGAAATCTTTGGCTAAAATGCAGTTTAATAACTGCATTTTTATTTTGCATAAAAATAAGGGATAA |
| Sequence |
MARRCEICNKGVVAGVQYSHSHRQSKRTWAPNIKKVKAIVKGTPKTVHVCTRCLRSEKFKELYKKSLAKMQFNNCIFILHKNKG |
| Source of smORF |
Swiss-Prot |
| Function |
The ORF matches to the profile of cl00367. Profile Description: Ribosomal L28 family. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture (e.g. SP|P36525 from Saccharomyces cerevisiae, which is 258 amino acids long) and are not included. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID |
11792842
|
| Domain |
CDD:412338 |
| Functional Category |
Ribosomal_protein |
| Uniprot ID |
Q8XJM2
|
| ORF Length (Amino Acid) |
84 |