Protein name |
50S ribosomal protein L28 |
NCBI Accession ID |
BA000016.3 |
Organism |
Clostridium perfringens (strain 13 / Type A) |
Left |
2011513 |
Right |
2011767 |
Strand |
+ |
Nucleotide Sequence |
ATGGCAAGAAGATGCGAGATTTGTAACAAAGGAGTTGTAGCTGGAGTACAATACAGTCACTCTCACAGACAATCAAAGAGAACTTGGGCTCCTAACATAAAAAAGGTTAAAGCAATCGTTAAAGGAACACCAAAAACTGTTCACGTTTGTACAAGATGCTTAAGATCGGAAAAGTTCAAAGAGCTATATAAGAAATCTTTGGCTAAAATGCAGTTTAATAACTGCATTTTTATTTTGCATAAAAATAAGGGATAA |
Sequence |
MARRCEICNKGVVAGVQYSHSHRQSKRTWAPNIKKVKAIVKGTPKTVHVCTRCLRSEKFKELYKKSLAKMQFNNCIFILHKNKG |
Source of smORF |
Swiss-Prot |
Function |
The ORF matches to the profile of cl00367. Profile Description: Ribosomal L28 family. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture (e.g. SP|P36525 from Saccharomyces cerevisiae, which is 258 amino acids long) and are not included. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
Pubmed ID |
11792842
|
Domain |
CDD:412338 |
Functional Category |
Ribosomal_protein |
Uniprot ID |
Q8XJM2
|
ORF Length (Amino Acid) |
84 |