Result : Q8XAT0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | rho operon leader peptide |
| NCBI Accession ID | AE005174.2 |
| Organism | Escherichia coli O157:H7 |
| Left | 4828622 |
| Right | 4828723 |
| Strand | + |
| Nucleotide Sequence | ATGCGAAGTGAACAGATTTCTGGCTCGTCACTCAATCCGTCTTGTCGTTTCAGTTCTGCGTACTCTCCTGTGACCAGGCAGCGAAAAGACATGAGTCGATGA |
| Sequence | MRSEQISGSSLNPSCRFSSAYSPVTRQRKDMSR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of PRK09979. Profile Description: rho operon leader peptide rhoL. |
| Pubmed ID | 11206551 11258796 |
| Domain | CDD:77522 |
| Functional Category | Others |
| Uniprot ID | Q8XAT0 |
| ORF Length (Amino Acid) | 33 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4759763 | 4759864 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 3966231 | 3966332 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 3974795 | 3974896 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 4296464 | 4296565 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 4378694 | 4378795 | - | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 2808790 | 2808888 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 7 | 3935396 | 3935494 | + | NZ_AP014857.1 | Escherichia albertii |
| 8 | 119863 | 119946 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 9 | 3356252 | 3356359 | - | NZ_CP038469.1 | Citrobacter tructae |
| 10 | 4505380 | 4505478 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 11 | 4189061 | 4189153 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134340.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13361.8 | 0.9 | 9 | 3531.0 | same-strand | UvrD-like helicase C-terminal domain |
| 2 | PF00580.23 | 0.9 | 9 | 3531.0 | same-strand | UvrD/REP helicase N-terminal domain |
| 3 | PF13245.8 | 0.9 | 9 | 3531.0 | same-strand | AAA domain |
| 4 | PF13538.8 | 0.9 | 9 | 3531.0 | same-strand | UvrD-like helicase C-terminal domain |
| 5 | PF02541.18 | 1.0 | 10 | 2000 | opposite-strand | Ppx/GppA phosphatase family |
| 6 | PF00270.31 | 1.0 | 10 | 601 | opposite-strand | DEAD/DEAH box helicase |
| 7 | PF00271.33 | 1.0 | 10 | 601 | opposite-strand | Helicase conserved C-terminal domain |
| 8 | PF00085.22 | 1.0 | 10 | 141 | same-strand | Thioredoxin |
| 9 | PF13098.8 | 1.0 | 10 | 141 | same-strand | Thioredoxin-like domain |
| 10 | PF07497.14 | 1.0 | 10 | 85 | same-strand | Rho termination factor, RNA-binding domain |
| 11 | PF00006.27 | 1.0 | 10 | 85 | same-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
| 12 | PF07498.14 | 1.0 | 10 | 85 | same-strand | Rho termination factor, N-terminal domain |
| 13 | PF00953.23 | 1.0 | 10 | 1584 | same-strand | Glycosyl transferase family 4 |
| 14 | PF02706.17 | 0.6 | 6 | 2699 | same-strand | Chain length determinant protein |
| 15 | PF02350.21 | 1.0 | 10 | 3801 | same-strand | UDP-N-acetylglucosamine 2-epimerase |
| 16 | PF03721.16 | 0.6 | 6 | 4929.5 | same-strand | UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain |
| 17 | PF00984.21 | 0.6 | 6 | 4929.5 | same-strand | UDP-glucose/GDP-mannose dehydrogenase family, central domain |
| 18 | PF03720.17 | 0.6 | 6 | 4929.5 | same-strand | UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain |
++ More..