Result : Q8X7P0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YkfJ |
| NCBI Accession ID | AE005174.2 |
| Organism | Escherichia coli O157:H7 |
| Left | 291355 |
| Right | 291621 |
| Strand | + |
| Nucleotide Sequence | ATGGAATGGTACATGGGCAAATATATTCGTCCCTTATCCGATGCGGTATTTACCATCGCATCTGATGACCTGTGGATCGAGAGTTTAGCGATCCAACAATTACACACCACGGCAAATTTACCCAACATGCAGCGCGTAGTGGGGATGCCAGATTTACACCCCGGACGCGGCTACCCGATTGGCGCAGCGTTCTTCTCTGTTGGTCGTTTTTACCCGACAAGACGTCGCGGTAACGGTGCTGGAAACAGAAACGGGCCGCTACTCTGA |
| Sequence | MEWYMGKYIRPLSDAVFTIASDDLWIESLAIQQLHTTANLPNMQRVVGMPDLHPGRGYPIGAAFFSVGRFYPTRRRGNGAGNRNGPLL |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 11206551 11258796 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q8X7P0 |
| ORF Length (Amino Acid) | 88 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 291355 | 291621 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 253467 | 253733 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 3145738 | 3146004 | + | NZ_CP061527.1 | Shigella dysenteriae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP061527.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00691.22 | 1.0 | 2 | 2640 | same-strand | OmpA family |
| 2 | PF00817.22 | 1.0 | 2 | 1514 | same-strand | impB/mucB/samB family |
| 3 | PF11799.10 | 1.0 | 2 | 1514 | same-strand | impB/mucB/samB family C-terminal domain |
| 4 | PF11798.10 | 1.0 | 2 | 1514 | same-strand | IMS family HHH motif |
| 5 | PF01546.30 | 1.0 | 2 | 526 | opposite-strand | Peptidase family M20/M25/M40 |
| 6 | PF07687.16 | 1.0 | 2 | 526 | opposite-strand | Peptidase dimerisation domain |
| 7 | PF00156.29 | 1.0 | 2 | 2244 | same-strand | Phosphoribosyl transferase domain |
| 8 | PF06500.13 | 1.0 | 2 | 2794 | same-strand | Esterase FrsA-like |
| 9 | PF07417.14 | 1.0 | 2 | 4096.0 | same-strand | Sigma factor-binding transcriptional regulator Crl |
| 10 | PF03400.15 | 1.0 | 2 | 3981.5 | opposite-strand | IS1 transposase |
++ More..