Result : A9HLS1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | RNA-binding protein Hfq |
| NCBI Accession ID | AM889285.1 |
| Organism | Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5) |
| Left | 2319996 |
| Right | 2320292 |
| Strand | - |
| Nucleotide Sequence | GTGGCAAAAGAACCGACACAAAACGTTCAGGATGTCTTCCTCAACCATGTCCGACGGTCCAAGACCCCGGTCACGGTGTTCCTGGTCAATGGCGTAAAGCTGCAGGGCATCATTACCTGGTTTGACAATTTCTCGGTGCTGCTGCGTCGCGACGGTCATACGCAGCTTGTCTACAAGCACGCCATCAGCACCGTCATGCCGGCGACGCCGGTGGTCCTGTTCGACCCGTCGCGCACCGAAGGCGCCACCGTTGACCTGACGGAGAAGGATCTGGCGGGGGATGCCGATCTCCTCTGA |
| Sequence | MAKEPTQNVQDVFLNHVRRSKTPVTVFLVNGVKLQGIITWFDNFSVLLRRDGHTQLVYKHAISTVMPATPVVLFDPSRTEGATVDLTEKDLAGDADLL |
| Source of smORF | Swiss-Prot |
| Function | RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs. {ECO:0000255|HAMAP-Rule:MF_00436}. |
| Pubmed ID | 19775431 21304715 |
| Domain | CDD:412267 |
| Functional Category | RNA-binding |
| Uniprot ID | A9HLS1 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 143
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 655568 | 655852 | + | NZ_CP050139.1 | Komagataeibacter rhaeticus |
| 2 | 2987196 | 2987480 | - | NZ_CP062147.1 | Komagataeibacter hansenii |
| 3 | 2756880 | 2757164 | + | NC_016027.1 | Komagataeibacter medellinensis NBRC 3288 |
| 4 | 2666773 | 2667057 | + | NZ_CP036404.1 | Komagataeibacter saccharivorans |
| 5 | 2293224 | 2293532 | + | NZ_CP053708.1 | Lichenicola cladoniae |
| 6 | 1247364 | 1247645 | + | NZ_CP003182.2 | Granulibacter bethesdensis CGDNIH4 |
| 7 | 1499772 | 1500029 | - | NC_017059.1 | Pararhodospirillum photometricum DSM 122 |
| 8 | 1080084 | 1080371 | - | NZ_CP029176.1 | Acidibrevibacterium fodinaquatile |
| 9 | 1187282 | 1187536 | - | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 10 | 1986158 | 1986454 | - | NZ_CP060244.1 | Entomobacter blattae |
| 11 | 1976387 | 1976638 | + | NC_017584.1 | Rhodospirillum rubrum F11 |
| 12 | 1449752 | 1450000 | - | NZ_CP029353.1 | Azospirillum thermophilum |
| 13 | 2577694 | 2577948 | + | NC_007626.1 | Magnetospirillum magneticum AMB-1 |
| 14 | 1012168 | 1012416 | - | NZ_CP029829.1 | Azospirillum ramasamyi |
| 15 | 1686756 | 1687004 | + | NZ_CP054619.1 | Azospirillum oryzae |
| 16 | 2641590 | 2641838 | - | NZ_CP012401.1 | Azospirillum thiophilum |
| 17 | 4282551 | 4282802 | + | NZ_CP048630.1 | Ancylobacter pratisalsi |
| 18 | 3095146 | 3095415 | + | NZ_CP041636.1 | Ferrovibrio terrae |
| 19 | 2897457 | 2897705 | + | NZ_CP030265.1 | Skermanella pratensis |
| 20 | 1853104 | 1853355 | - | NC_014217.1 | Starkeya novella DSM 506 |
| 21 | 1199894 | 1200145 | + | NZ_CP015367.1 | Methylobacterium phyllosphaerae |
| 22 | 4442194 | 4442442 | - | NC_020453.1 | Bradyrhizobium oligotrophicum S58 |
| 23 | 1894923 | 1895174 | + | NZ_CP003811.1 | Methylobacterium oryzae CBMB20 |
| 24 | 2003417 | 2003677 | - | NZ_AP018907.1 | Blastochloris tepida |
| 25 | 4278149 | 4278397 | + | NZ_CP017147.1 | Bosea vaviloviae |
| 26 | 3275460 | 3275723 | - | NZ_CP044331.1 | Methylocystis parvus |
| 27 | 4781219 | 4781476 | + | NZ_CP021112.1 | Pseudorhodoplanes sinuspersici |
| 28 | 6632833 | 6633087 | + | NC_011894.1 | Methylobacterium nodulans ORS 2060 |
| 29 | 2926032 | 2926286 | + | NZ_CP039546.1 | Methylorubrum populi |
| 30 | 446713 | 446964 | - | NZ_CP043538.1 | Methylobacterium mesophilicum SR1.6/6 |
| 31 | 5692003 | 5692254 | + | NZ_CP029550.1 | Methylobacterium durans |
| 32 | 1560490 | 1560741 | + | NC_010505.1 | Methylobacterium radiotolerans JCM 2831 |
| 33 | 3075499 | 3075744 | + | NZ_AP014946.1 | Variibacter gotjawalensis |
| 34 | 2225025 | 2225279 | - | NZ_CP041690.1 | Youhaiella tibetensis |
| 35 | 3964978 | 3965232 | + | NZ_CP068983.1 | Paradevosia shaoguanensis |
| 36 | 2461639 | 2461878 | + | NZ_LT960614.1 | Hartmannibacter diazotrophicus |
| 37 | 1144173 | 1144424 | - | NZ_CP042304.1 | Devosia ginsengisoli |
| 38 | 2026845 | 2027090 | - | NZ_CP053086.1 | Pelagibacterium halotolerans |
| 39 | 5638264 | 5638518 | - | NZ_CP029553.1 | Methylobacterium terrae |
| 40 | 5937954 | 5938202 | - | NZ_CP050066.1 | Bradyrhizobium symbiodeficiens |
| 41 | 3279028 | 3279276 | + | NZ_CP029426.1 | Bradyrhizobium amphicarpaeae |
| 42 | 6983087 | 6983335 | - | NZ_CP044543.1 | Bradyrhizobium betae |
| 43 | 3808510 | 3808758 | - | NZ_CP030053.1 | Bradyrhizobium guangzhouense |
| 44 | 3159529 | 3159777 | + | NZ_CP022219.1 | Bradyrhizobium guangxiense |
| 45 | 3795847 | 3796095 | - | NC_017082.1 | Bradyrhizobium cosmicum |
| 46 | 3990084 | 3990332 | + | NZ_CP030051.1 | Bradyrhizobium guangdongense |
| 47 | 4174113 | 4174361 | - | NZ_LS398110.1 | Bradyrhizobium vignae |
| 48 | 6540238 | 6540486 | - | NZ_CP029425.1 | Bradyrhizobium ottawaense |
| 49 | 4911006 | 4911254 | + | NZ_CP032617.1 | Bradyrhizobium diazoefficiens |
| 50 | 4726440 | 4726688 | + | NZ_CP058354.1 | Bradyrhizobium japonicum |
| 51 | 5288065 | 5288313 | + | NZ_CP030050.1 | Bradyrhizobium arachidis |
| 52 | 2431004 | 2431261 | - | NC_015259.1 | Polymorphum gilvum SL003B-26A1 |
| 53 | 2766525 | 2766773 | + | NZ_CP058907.1 | Rhodopseudomonas palustris |
| 54 | 3208050 | 3208295 | + | NZ_CP022048.2 | Brevundimonas vesicularis |
| 55 | 1773345 | 1773590 | + | NC_014375.1 | Brevundimonas subvibrioides ATCC 15264 |
| 56 | 2234271 | 2234525 | + | NZ_AP014648.1 | Methyloceanibacter caenitepidi |
| 57 | 2930000 | 2930254 | - | NZ_CP025086.1 | Methylovirgula ligni |
| 58 | 1459366 | 1459614 | - | NC_014664.1 | Rhodomicrobium vannielii ATCC 17100 |
| 59 | 1579087 | 1579332 | - | NZ_LR588407.1 | Brevundimonas vancanneytii |
| 60 | 1548381 | 1548641 | + | NZ_CP018911.1 | Glycocaulis alkaliphilus |
| 61 | 1489852 | 1490091 | + | NZ_CP010855.1 | Marinovum algicola DG 898 |
| 62 | 1727075 | 1727329 | + | NC_010581.1 | Beijerinckia indica subsp. indica ATCC 9039 |
| 63 | 595349 | 595600 | + | NC_011666.1 | Methylocella silvestris BL2 |
| 64 | 1397540 | 1397788 | - | NZ_CP029479.1 | Phenylobacterium parvum |
| 65 | 3148360 | 3148626 | + | NZ_CP030918.1 | Paracoccus suum |
| 66 | 977965 | 978225 | + | NZ_CP046052.1 | Methylocystis heyeri |
| 67 | 3117337 | 3117582 | - | NZ_CP015064.1 | Mesorhizobium ciceri biovar biserrulae |
| 68 | 289516 | 289761 | + | NC_002678.2 | Mesorhizobium japonicum MAFF 303099 |
| 69 | 6136817 | 6137062 | + | NZ_CP050296.1 | Mesorhizobium huakuii |
| 70 | 4138803 | 4139048 | - | NZ_CP015318.1 | Mesorhizobium amorphae CCNWGS0123 |
| 71 | 4660681 | 4660926 | - | NC_015675.1 | Mesorhizobium opportunistum WSM2075 |
| 72 | 4704322 | 4704567 | - | NZ_CP033507.1 | Mesorhizobium jarvisii |
| 73 | 4066760 | 4067005 | - | NZ_CP033361.1 | Mesorhizobium erdmanii |
| 74 | 4451430 | 4451690 | - | NZ_CP019948.1 | Methylocystis bryophila |
| 75 | 4235733 | 4235978 | - | NC_019973.1 | Mesorhizobium australicum WSM2073 |
| 76 | 2050520 | 2050768 | + | NZ_CP021330.1 | Maritalea myrionectae |
| 77 | 982248 | 982496 | - | NZ_CP071057.1 | Marinicauda algicola |
| 78 | 1272491 | 1272739 | - | NC_016026.1 | Micavibrio aeruginosavorus ARL-13 |
| 79 | 1829403 | 1829654 | + | NZ_CP036532.1 | Roseitalea porphyridii |
| 80 | 2683228 | 2683479 | - | NZ_CP032509.1 | Georhizobium profundi |
| 81 | 1788321 | 1788581 | - | NZ_CP042808.1 | Acetobacter oryzoeni |
| 82 | 686514 | 686774 | - | NC_021991.1 | Acetobacter pasteurianus 386B |
| 83 | 1441023 | 1441283 | - | NZ_CP015164.1 | Acetobacter ascendens |
| 84 | 2918971 | 2919216 | + | NZ_LN606600.1 | Acetobacter senegalensis |
| 85 | 2011299 | 2011583 | - | NZ_CP022374.1 | Acetobacter oryzifermentans |
| 86 | 2726985 | 2727233 | + | NZ_CP072611.1 | Aureimonas populi |
| 87 | 1297220 | 1297459 | - | NC_012846.1 | Bartonella grahamii as4aup |
| 88 | 3068800 | 3069042 | - | NZ_CP049241.1 | Rhizobium pseudoryzae |
| 89 | 681154 | 681396 | - | NZ_CP048632.1 | Rhizobium oryzihabitans |
| 90 | 2028128 | 2028370 | + | NZ_CP032694.1 | Rhizobium jaguaris |
| 91 | 1653064 | 1653303 | + | NZ_CP058235.1 | Bartonella alsatica |
| 92 | 1056753 | 1056995 | + | NZ_CP061003.1 | Agrobacterium tumefaciens |
| 93 | 389325 | 389582 | - | NZ_CP043043.1 | Gluconobacter thailandicus |
| 94 | 1885432 | 1885683 | - | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 95 | 1491979 | 1492236 | + | NZ_CP038141.1 | Swingsia samuiensis |
| 96 | 2198881 | 2199132 | - | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 97 | 2926629 | 2926880 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 98 | 3313957 | 3314217 | - | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 99 | 3159583 | 3159846 | + | NZ_CP009977.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
| 100 | 1647532 | 1647789 | + | NZ_CP012900.1 | Stenotrophomonas acidaminiphila |
| 101 | 768004 | 768270 | + | NZ_CP012621.1 | Zobellella denitrificans |
| 102 | 3541367 | 3541630 | - | NZ_CP009467.1 | Vibrio harveyi |
| 103 | 3936187 | 3936453 | + | NZ_CP031961.1 | Pseudoalteromonas tunicata |
| 104 | 5044795 | 5045073 | + | NZ_CP018725.1 | Xanthomonas vesicatoria ATCC 35937 |
| 105 | 478248 | 478526 | + | NZ_CP016878.1 | Xanthomonas hortorum |
| 106 | 2023116 | 2023394 | + | NZ_CP048044.1 | Xanthomonas citri |
| 107 | 1707983 | 1708243 | - | NZ_CP071517.1 | Lysobacter arenosi |
| 108 | 1650960 | 1651202 | + | NZ_LS483377.1 | Stenotrophomonas maltophilia |
| 109 | 2021401 | 2021679 | + | NZ_CP072268.1 | Xanthomonas euvesicatoria pv. alfalfae |
| 110 | 90411 | 90671 | + | NZ_CP016414.1 | Vibrio scophthalmi |
| 111 | 2965307 | 2965570 | - | NZ_CP030788.1 | Vibrio campbellii |
| 112 | 284933 | 285196 | + | NZ_CP031781.1 | Vibrio parahaemolyticus |
| 113 | 2966101 | 2966364 | - | NZ_CP009354.1 | Vibrio tubiashii ATCC 19109 |
| 114 | 82155 | 82418 | + | NZ_CP018312.1 | Vibrio rotiferianus |
| 115 | 2498639 | 2498899 | + | NZ_CP021377.1 | Oceanisphaera profunda |
| 116 | 2114467 | 2114730 | + | NZ_CP019959.1 | Vibrio owensii |
| 117 | 2535747 | 2536010 | + | NZ_CP025792.1 | Vibrio jasicida 090810c |
| 118 | 2912044 | 2912322 | - | NZ_CP028127.1 | Xanthomonas vasicola pv. vasculorum |
| 119 | 1706939 | 1707217 | + | NZ_CP033326.1 | Xanthomonas cucurbitae |
| 120 | 304348 | 304614 | + | NZ_CP045350.1 | Vibrio aquimaris |
| 121 | 2534676 | 2534954 | - | NZ_LT853882.1 | Xanthomonas fragariae |
| 122 | 2259499 | 2259741 | + | NZ_CP015249.1 | Dokdonella koreensis DS-123 |
| 123 | 2461095 | 2461373 | - | NZ_CP007810.1 | Xanthomonas oryzae pv. oryzicola |
| 124 | 4012658 | 4012912 | - | NZ_CP031769.1 | Salinimonas sediminis |
| 125 | 4290317 | 4290577 | - | NZ_CP009365.1 | Pseudomonas soli |
| 126 | 1259447 | 1259692 | + | NZ_AP018722.1 | Thiomicrorhabdus aquaedulcis |
| 127 | 2916482 | 2916760 | - | NZ_CP058243.1 | Xanthomonas campestris pv. raphani |
| 128 | 1109699 | 1109959 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 129 | 3090276 | 3090518 | - | NZ_CP041046.1 | Luteibacter pinisoli |
| 130 | 3956912 | 3957169 | - | NC_008345.1 | Shewanella frigidimarina NCIMB 400 |
| 131 | 5708570 | 5708812 | - | NZ_CP018632.1 | Granulosicoccus antarcticus IMCC3135 |
| 132 | 622297 | 622566 | + | NC_008340.1 | Alkalilimnicola ehrlichii MLHE-1 |
| 133 | 1157774 | 1158016 | - | NZ_CP007501.1 | Polynucleobacter duraquae |
| 134 | 2946538 | 2946783 | - | NZ_CP021455.1 | Comamonas serinivorans |
| 135 | 1392143 | 1392406 | - | NZ_CP072133.1 | Pseudoalteromonas xiamenensis |
| 136 | 4243091 | 4243366 | - | NZ_CP046378.1 | Shewanella algae |
| 137 | 3460892 | 3461137 | - | NZ_CP042382.1 | Pistricoccus aurantiacus |
| 138 | 748883 | 749155 | - | NC_008789.1 | Halorhodospira halophila SL1 |
| 139 | 3929133 | 3929384 | - | NZ_CP008849.1 | Alteromonas australica |
| 140 | 4276105 | 4276356 | - | NZ_CP014322.1 | Alteromonas addita |
| 141 | 4470604 | 4470855 | - | NC_015554.1 | Alteromonas naphthalenivorans |
| 142 | 1285119 | 1285376 | + | NZ_CP035033.1 | Hydrogenovibrio thermophilus |
| 143 | 2932575 | 2932826 | - | NZ_CP021435.1 | Halomonas beimenensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP050139.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02518.28 | 0.6 | 86 | 3491.5 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 2 | PF00512.27 | 0.6 | 86 | 3491.5 | same-strand | His Kinase A (phospho-acceptor) domain |
| 3 | PF00158.28 | 0.61 | 87 | 2500.5 | same-strand | Sigma-54 interaction domain |
| 4 | PF00072.26 | 0.61 | 87 | 2500.5 | same-strand | Response regulator receiver domain |
| 5 | PF14532.8 | 0.61 | 87 | 2565 | same-strand | Sigma-54 interaction domain |
| 6 | PF02954.21 | 0.61 | 87 | 2566.5 | same-strand | Bacterial regulatory protein, Fis family |
| 7 | PF00672.27 | 0.6 | 86 | 2368.5 | same-strand | HAMP domain |
| 8 | PF16360.7 | 0.99 | 142 | 15.0 | same-strand | GTP-binding GTPase Middle Region |
| 9 | PF13167.8 | 0.98 | 140 | 13.5 | same-strand | GTP-binding GTPase N-terminal |
| 10 | PF01926.25 | 0.99 | 142 | 18.0 | same-strand | 50S ribosome-binding GTPase |
++ More..