Result : Q8X6E3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative uncharacterized protein Z0387/ECs0347 |
| NCBI Accession ID | AE005174.2 |
| Organism | Escherichia coli O157:H7 |
| Left | 367125 |
| Right | 367337 |
| Strand | - |
| Nucleotide Sequence | ATGGATGCCTGTCTTTTTCACTGTAAATATCCTGGCATTAGTAATGCCAGGATATTTACAGAAGAGGAGCATAACCATGACGGAACGGGGTTAAGTCAGGTTGTCCTTAACGCTATTTTCAACCTCGTATGCCTTCTTCAGGTTTATGTCCAGACTTCATACCTCTCTCAGCAATCCTCAATAATCAGATACACCGCTTTCACCGGACCATGA |
| Sequence | MDACLFHCKYPGISNARIFTEEEHNHDGTGLSQVVLNAIFNLVCLLQVYVQTSYLSQQSSIIRYTAFTGP |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 11206551 11258796 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q8X6E3 |
| ORF Length (Amino Acid) | 70 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 367123 | 367335 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 324408 | 324620 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 274946 | 275158 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02754.18 | 1.0 | 2 | 2081 | opposite-strand | Cysteine-rich domain |
| 2 | PF02589.17 | 1.0 | 2 | 299.0 | opposite-strand | LUD domain |
| 3 | PF13183.8 | 1.0 | 2 | 643 | opposite-strand | 4Fe-4S dicluster domain |
| 4 | PF11870.10 | 1.0 | 2 | 643 | opposite-strand | Domain of unknown function (DUF3390) |
| 5 | PF13237.8 | 1.0 | 2 | 643 | opposite-strand | 4Fe-4S dicluster domain |
| 6 | PF13534.8 | 1.0 | 2 | 643 | opposite-strand | 4Fe-4S dicluster domain |
| 7 | PF13187.8 | 1.0 | 2 | 643 | opposite-strand | 4Fe-4S dicluster domain |
| 8 | PF12838.9 | 1.0 | 2 | 643 | opposite-strand | 4Fe-4S dicluster domain |
| 9 | PF20130.1 | 1.0 | 2 | 76 | same-strand | Family of unknown function (DUF6520) |
++ More..