Result : Q8UAX0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cell division topological specificity factor |
| NCBI Accession ID | AE007870.2 |
| Organism | Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) |
| Left | 265951 |
| Right | 266211 |
| Strand | - |
| Nucleotide Sequence | ATGAGCATCTTCAGTATCTTCCGTAAACAGAAGTCCGCACCGCTTGCGCGTGAACGCCTGCAGGTGCTGCTCGCCCACGAAAGGGCGTCGTCGGGAACCGATCTCGTCGCCGTTCTGCGGGAAGAAATTCTTAGCGTCATCGCCAAGCATGTACAGATCGACAATGACCGGGTGCATGTGAAAATGGATCGCGACGAACATGTCTCCATATTGGAGATCGATGTCGAAATTCCGTTGGGCGCCCATCTGCGCGCTGCATAA |
| Sequence | MSIFSIFRKQKSAPLARERLQVLLAHERASSGTDLVAVLREEILSVIAKHVQIDNDRVHVKMDRDEHVSILEIDVEIPLGAHLRAA |
| Source of smORF | Swiss-Prot |
| Function | Prevents the cell division inhibition by proteins MinC and MinD at internal division sites while permitting inhibition at polar sites. This ensures cell division at the proper site by restricting the formation of a division septum at the midpoint of the long axis of the cell. {ECO:0000255|HAMAP-Rule:MF_00262}. |
| Pubmed ID | 11743193 11743194 |
| Domain | CDD:412433 |
| Functional Category | Others |
| Uniprot ID | Q8UAX0 |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 89
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 252865 | 253125 | - | NZ_CP048635.1 | Rhizobium oryzihabitans |
| 2 | 299120 | 299380 | - | NZ_CP061004.1 | Agrobacterium tumefaciens |
| 3 | 1749081 | 1749341 | + | NZ_CP053857.1 | Rhizobium pusense |
| 4 | 592027 | 592287 | + | NZ_CP049244.1 | Rhizobium pseudoryzae |
| 5 | 1313794 | 1314054 | - | NZ_CP059897.1 | Ciceribacter thiooxidans |
| 6 | 1212887 | 1213147 | + | NZ_CP006880.1 | Rhizobium gallicum bv. gallicum R602sp |
| 7 | 2414109 | 2414369 | - | NZ_HG938353.1 | Neorhizobium galegae bv. orientalis str. HAMBI 540 |
| 8 | 1174621 | 1174881 | + | NZ_CP049249.1 | Rhizobium rhizoryzae |
| 9 | 1471458 | 1471718 | - | NC_020062.1 | Rhizobium tropici CIAT 899 |
| 10 | 3741175 | 3741435 | - | NZ_LR723670.1 | Pseudorhizobium flavum |
| 11 | 3758496 | 3758756 | - | NZ_FO082820.1 | Pseudorhizobium banfieldiae |
| 12 | 1611122 | 1611385 | - | NZ_CP029452.1 | Sinorhizobium fredii CCBAU 25509 |
| 13 | 699025 | 699288 | + | NZ_CP041241.1 | Ensifer mexicanus |
| 14 | 225434 | 225694 | - | NZ_CP054029.1 | Rhizobium hidalgonense |
| 15 | 173352 | 173612 | - | NZ_CP054023.1 | Rhizobium indicum |
| 16 | 391273 | 391533 | - | NZ_CP071607.1 | Rhizobium binae |
| 17 | 20976 | 21236 | + | NZ_CP035001.1 | Rhizobium acidisoli |
| 18 | 2183621 | 2183881 | - | NZ_CP032695.1 | Rhizobium jaguaris |
| 19 | 347939 | 348199 | - | NZ_CP013534.1 | Rhizobium phaseoli |
| 20 | 126620 | 126880 | + | NZ_CP071456.1 | Rhizobium lentis |
| 21 | 453084 | 453344 | - | NZ_CP013503.1 | Rhizobium esperanzae |
| 22 | 1444848 | 1445108 | - | NZ_CP013110.1 | Sinorhizobium americanum |
| 23 | 17838 | 18098 | - | NZ_CP034910.1 | Ensifer alkalisoli |
| 24 | 413682 | 413942 | - | NZ_CP071614.1 | Rhizobium bangladeshense |
| 25 | 364803 | 365063 | + | NZ_CP023068.1 | Ensifer sojae CCBAU 05684 |
| 26 | 1446114 | 1446377 | - | NC_020560.1 | Sinorhizobium meliloti 2011 |
| 27 | 451738 | 451998 | - | NZ_CP020909.1 | Rhizobium etli |
| 28 | 595064 | 595324 | - | NZ_CP071680.1 | Rhizobium ruizarguesonis |
| 29 | 2872990 | 2873256 | + | NZ_CP032509.1 | Georhizobium profundi |
| 30 | 866970 | 867242 | - | NC_007624.1 | Brucella abortus 2308 |
| 31 | 948430 | 948702 | - | NC_022906.1 | Brucella ceti TE10759-12 |
| 32 | 303619 | 303891 | + | NC_009504.1 | Brucella ovis ATCC 25840 |
| 33 | 965984 | 966256 | - | NC_003318.1 | Brucella melitensis bv. 1 str. 16M |
| 34 | 304496 | 304768 | + | NC_010104.1 | Brucella canis ATCC 23365 |
| 35 | 304382 | 304654 | + | NC_004311.2 | Brucella suis 1330 |
| 36 | 305666 | 305938 | + | NC_013118.1 | Brucella microti CCM 4915 |
| 37 | 202193 | 202465 | + | NZ_LT605586.1 | Brucella inopinata |
| 38 | 1585629 | 1585898 | - | NZ_CP064062.1 | Brucella anthropi |
| 39 | 1923869 | 1924153 | - | NC_010581.1 | Beijerinckia indica subsp. indica ATCC 9039 |
| 40 | 2898270 | 2898542 | + | NZ_CP033361.1 | Mesorhizobium erdmanii |
| 41 | 262989 | 263273 | - | NZ_CP072611.1 | Aureimonas populi |
| 42 | 3445879 | 3446151 | + | NZ_CP033507.1 | Mesorhizobium jarvisii |
| 43 | 3066841 | 3067113 | + | NZ_CP015318.1 | Mesorhizobium amorphae CCNWGS0123 |
| 44 | 1605044 | 1605316 | - | NC_002678.2 | Mesorhizobium japonicum MAFF 303099 |
| 45 | 3178559 | 3178831 | + | NC_019973.1 | Mesorhizobium australicum WSM2073 |
| 46 | 2973311 | 2973595 | + | NC_011894.1 | Methylobacterium nodulans ORS 2060 |
| 47 | 5600194 | 5600463 | + | NC_011894.1 | Methylobacterium nodulans ORS 2060 |
| 48 | 1386444 | 1386725 | - | NZ_CP016616.1 | Microvirga ossetica |
| 49 | 2361971 | 2362240 | - | NZ_CP016616.1 | Microvirga ossetica |
| 50 | 5172575 | 5172841 | + | NZ_CP039690.1 | Phreatobacter stygius |
| 51 | 2087223 | 2087492 | - | NZ_CP018171.1 | Mesorhizobium oceanicum |
| 52 | 4093427 | 4093699 | - | NZ_CP015064.1 | Mesorhizobium ciceri biovar biserrulae |
| 53 | 1625472 | 1625732 | + | NZ_CP015881.1 | Ensifer adhaerens |
| 54 | 1321432 | 1321695 | - | NZ_CP024201.1 | Caulobacter mirabilis |
| 55 | 607468 | 607734 | - | NZ_CP054836.1 | Oricola thermophila |
| 56 | 3348422 | 3348694 | + | NC_015675.1 | Mesorhizobium opportunistum WSM2075 |
| 57 | 696960 | 697232 | - | NZ_CP050296.1 | Mesorhizobium huakuii |
| 58 | 2348077 | 2348337 | + | NZ_CP029553.1 | Methylobacterium terrae |
| 59 | 5037708 | 5037977 | - | NZ_CP029553.1 | Methylobacterium terrae |
| 60 | 2463351 | 2463614 | - | NC_015186.1 | Acidiphilium multivorum AIU301 |
| 61 | 3066181 | 3066444 | - | NC_011144.1 | Phenylobacterium zucineum HLK1 |
| 62 | 1730048 | 1730317 | + | NZ_CP029550.1 | Methylobacterium durans |
| 63 | 1697889 | 1698158 | + | NZ_CP029550.1 | Methylobacterium durans |
| 64 | 3737314 | 3737577 | - | NZ_CP045423.1 | Microvirga thermotolerans |
| 65 | 1365880 | 1366143 | + | NZ_CP017147.1 | Bosea vaviloviae |
| 66 | 545392 | 545646 | + | NZ_CP003182.2 | Granulibacter bethesdensis CGDNIH4 |
| 67 | 1205987 | 1206262 | + | NC_020453.1 | Bradyrhizobium oligotrophicum S58 |
| 68 | 2646574 | 2646849 | - | NZ_CP036404.1 | Komagataeibacter saccharivorans |
| 69 | 7518269 | 7518559 | - | NZ_CP042968.1 | Bradyrhizobium paxllaeri |
| 70 | 4588175 | 4588450 | + | NZ_CP032617.1 | Bradyrhizobium diazoefficiens |
| 71 | 4093787 | 4094062 | - | NZ_CP030053.1 | Bradyrhizobium guangzhouense |
| 72 | 4434605 | 4434880 | - | NZ_LS398110.1 | Bradyrhizobium vignae |
| 73 | 3695251 | 3695526 | + | NZ_CP030051.1 | Bradyrhizobium guangdongense |
| 74 | 6216017 | 6216292 | - | NZ_CP050066.1 | Bradyrhizobium symbiodeficiens |
| 75 | 6844412 | 6844687 | - | NZ_CP029425.1 | Bradyrhizobium ottawaense |
| 76 | 5538404 | 5538679 | - | NZ_CP022221.1 | Bradyrhizobium zhanjiangense |
| 77 | 2574782 | 2575057 | - | NZ_CP019875.1 | Komagataeibacter nataicola |
| 78 | 2867610 | 2867885 | + | NZ_CP022219.1 | Bradyrhizobium guangxiense |
| 79 | 4895474 | 4895749 | + | NZ_CP030050.1 | Bradyrhizobium arachidis |
| 80 | 2996938 | 2997213 | + | NZ_CP029426.1 | Bradyrhizobium amphicarpaeae |
| 81 | 7552412 | 7552693 | - | NZ_CP016428.1 | Bradyrhizobium icense |
| 82 | 4141401 | 4141682 | - | NC_017082.1 | Bradyrhizobium cosmicum |
| 83 | 2650497 | 2650766 | + | NZ_CP060244.1 | Entomobacter blattae |
| 84 | 4422008 | 4422283 | + | NZ_CP058354.1 | Bradyrhizobium japonicum |
| 85 | 127663 | 127938 | - | NZ_CP044543.1 | Bradyrhizobium betae |
| 86 | 635253 | 635528 | - | NZ_CP050139.1 | Komagataeibacter rhaeticus |
| 87 | 1987626 | 1987907 | + | NZ_CP014689.1 | Gluconobacter albidus |
| 88 | 2787550 | 2787822 | + | NZ_CP048630.1 | Ancylobacter pratisalsi |
| 89 | 3827952 | 3828224 | + | NC_014217.1 | Starkeya novella DSM 506 |
| 90 | 496469 | 496747 | + | NZ_CP068419.1 | Gluconobacter sphaericus |
| 91 | 448060 | 448338 | + | NZ_CP004373.1 | Gluconobacter oxydans DSM 3504 |
| 92 | 3007938 | 3008222 | + | NZ_CP062147.1 | Komagataeibacter hansenii |
| 93 | 319426 | 319707 | + | NZ_CP043043.1 | Gluconobacter thailandicus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP059897.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01656.25 | 1.0 | 89 | -3 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 2 | PF13614.8 | 0.99 | 88 | -3.0 | same-strand | AAA domain |
| 3 | PF03775.18 | 0.98 | 87 | 846 | same-strand | Septum formation inhibitor MinC, C-terminal domain |
| 4 | PF10609.11 | 0.88 | 78 | -3 | same-strand | NUBPL iron-transfer P-loop NTPase |
++ More..