Result : Q8RIL3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0213 protein FN1575 |
| NCBI Accession ID | AE009951.2 |
| Organism | Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355) |
| Left | 86283 |
| Right | 86585 |
| Strand | - |
| Nucleotide Sequence | ATGGCTTATTATTTATATATGTTAAGATGTGAAGATGGAAGTATCTATACTGGTGTTGCAAAAGACTATTTGAAGAGATATGAAGAACATTTAAGTGCTAAGGGTGCAAAATATACAAAATCACATAAAGTTGTAAAAATTGAAAGGGTATTTTTATGTGACTCAAGATCAATAGCATGTAGTCTTGAAAGTGAAATAAAAAAATATATAAAAAAGAAAAAAGAGAATATAATAAGCAAACCAGATAGTTTTATAAAAGATATTGAGAATGTTAGAAAAATAAAAATAAAAAAAATTTTTTAA |
| Sequence | MAYYLYMLRCEDGSIYTGVAKDYLKRYEEHLSAKGAKYTKSHKVVKIERVFLCDSRSIACSLESEIKKYIKKKKENIISKPDSFIKDIENVRKIKIKKIF |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl15257. Profile Description: GIY-YIG nuclease domain superfamily. This domain was identified by Iyer and colleagues. |
| Pubmed ID | 11889109 |
| Domain | CDD:417687 |
| Functional Category | Others |
| Uniprot ID | Q8RIL3 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1175472 | 1175774 | - | NZ_CP024699.1 | Fusobacterium pseudoperiodonticum |
| 2 | 837671 | 837973 | + | NZ_CP013336.1 | Fusobacterium hwasookii ChDC F206 |
| 3 | 2204556 | 2204858 | - | NZ_LN831027.1 | Fusobacterium nucleatum subsp. polymorphum |
| 4 | 2266219 | 2266521 | - | NZ_CP068114.1 | Fusobacterium canifelinum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013336.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13177.8 | 1.0 | 4 | 11.0 | same-strand | DNA polymerase III, delta subunit |
| 2 | PF06723.15 | 1.0 | 4 | 883.0 | same-strand | MreB/Mbl protein |
| 3 | PF14450.8 | 1.0 | 4 | 883.0 | same-strand | Cell division protein FtsA |
| 4 | PF00636.28 | 1.0 | 4 | 1913.0 | same-strand | Ribonuclease III domain |
| 5 | PF01406.21 | 1.0 | 4 | 2290.0 | same-strand | tRNA synthetases class I (C) catalytic domain |
| 6 | PF09190.13 | 1.0 | 4 | 2290.0 | same-strand | DALR domain |
| 7 | PF01128.21 | 1.0 | 4 | 3730.0 | same-strand | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase |
| 8 | PF01713.23 | 0.75 | 3 | 1151 | same-strand | Smr domain |
| 9 | PF00793.22 | 0.75 | 3 | 1427 | same-strand | DAHP synthetase I family |
| 10 | PF02578.17 | 0.75 | 3 | 2431 | same-strand | Multi-copper polyphenol oxidoreductase laccase |
| 11 | PF00999.23 | 0.75 | 3 | 3725 | opposite-strand | Sodium/hydrogen exchanger family |
++ More..