Protein Information |
Information Type | Description |
---|---|
Protein name | UPF0213 protein FN1575 |
NCBI Accession ID | AE009951.2 |
Organism | Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355) |
Left | 86283 |
Right | 86585 |
Strand | - |
Nucleotide Sequence | ATGGCTTATTATTTATATATGTTAAGATGTGAAGATGGAAGTATCTATACTGGTGTTGCAAAAGACTATTTGAAGAGATATGAAGAACATTTAAGTGCTAAGGGTGCAAAATATACAAAATCACATAAAGTTGTAAAAATTGAAAGGGTATTTTTATGTGACTCAAGATCAATAGCATGTAGTCTTGAAAGTGAAATAAAAAAATATATAAAAAAGAAAAAAGAGAATATAATAAGCAAACCAGATAGTTTTATAAAAGATATTGAGAATGTTAGAAAAATAAAAATAAAAAAAATTTTTTAA |
Sequence | MAYYLYMLRCEDGSIYTGVAKDYLKRYEEHLSAKGAKYTKSHKVVKIERVFLCDSRSIACSLESEIKKYIKKKKENIISKPDSFIKDIENVRKIKIKKIF |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl15257. Profile Description: GIY-YIG nuclease domain superfamily. This domain was identified by Iyer and colleagues. |
Pubmed ID | 11889109 |
Domain | CDD:417687 |
Functional Category | Others |
Uniprot ID | Q8RIL3 |
ORF Length (Amino Acid) | 100 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1175472 | 1175774 | - | NZ_CP024699.1 | Fusobacterium pseudoperiodonticum |
2 | 837671 | 837973 | + | NZ_CP013336.1 | Fusobacterium hwasookii ChDC F206 |
3 | 2204556 | 2204858 | - | NZ_LN831027.1 | Fusobacterium nucleatum subsp. polymorphum |
4 | 2266219 | 2266521 | - | NZ_CP068114.1 | Fusobacterium canifelinum |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13177.8 | 1.0 | 4 | 11.0 | same-strand | DNA polymerase III, delta subunit |
2 | PF06723.15 | 1.0 | 4 | 883.0 | same-strand | MreB/Mbl protein |
3 | PF14450.8 | 1.0 | 4 | 883.0 | same-strand | Cell division protein FtsA |
4 | PF00636.28 | 1.0 | 4 | 1913.0 | same-strand | Ribonuclease III domain |
5 | PF01406.21 | 1.0 | 4 | 2290.0 | same-strand | tRNA synthetases class I (C) catalytic domain |
6 | PF09190.13 | 1.0 | 4 | 2290.0 | same-strand | DALR domain |
7 | PF01128.21 | 1.0 | 4 | 3730.0 | same-strand | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase |
8 | PF01713.23 | 0.75 | 3 | 1151 | same-strand | Smr domain |
9 | PF00793.22 | 0.75 | 3 | 1427 | same-strand | DAHP synthetase I family |
10 | PF02578.17 | 0.75 | 3 | 2431 | same-strand | Multi-copper polyphenol oxidoreductase laccase |
11 | PF00999.23 | 0.75 | 3 | 3725 | opposite-strand | Sodium/hydrogen exchanger family |