Result : Q8RIH4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L30 |
| NCBI Accession ID | AE009951.2 |
| Organism | Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355) |
| Left | 132954 |
| Right | 133139 |
| Strand | - |
| Nucleotide Sequence | ATGGCAAGACTTAGAATAGAGCTTGTAAAAAGCATTATCGGAAGAAAGCCTAATCATATAGCAACTGTAAAGTCGCTAGGGCTTAAGAAAATGCATGATGTAGTAGAACATAATGAAACACCTGAATTAAAAGGAAAATTAGCTCAAGTTTCTTATTTGTTAAAAGTTGAGGAGGTGCAAGCATAG |
| Sequence | MARLRIELVKSIIGRKPNHIATVKSLGLKKMHDVVEHNETPELKGKLAQVSYLLKVEEVQA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00203. Profile Description: N/A. This family includes prokaryotic L30 and eukaryotic L7. |
| Pubmed ID | 11889109 |
| Domain | CDD:412218 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q8RIH4 |
| ORF Length (Amino Acid) | 61 |
++ More..
| Conservation Analysis |
No. of Species: 130
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 521650 | 521835 | + | NZ_CP068114.1 | Fusobacterium canifelinum |
| 2 | 573283 | 573468 | + | NZ_CP013336.1 | Fusobacterium hwasookii ChDC F206 |
| 3 | 433966 | 434151 | + | NZ_LN831027.1 | Fusobacterium nucleatum subsp. polymorphum |
| 4 | 1681214 | 1681399 | + | NZ_CP024699.1 | Fusobacterium pseudoperiodonticum |
| 5 | 403810 | 403995 | - | NZ_CP028102.1 | Fusobacterium mortiferum ATCC 9817 |
| 6 | 1136121 | 1136306 | + | NZ_CP028103.1 | Fusobacterium varium ATCC 27725 |
| 7 | 1461156 | 1461341 | + | NZ_CP028105.1 | Fusobacterium ulcerans |
| 8 | 391362 | 391547 | + | NZ_CP028106.1 | Fusobacterium gonidiaformans ATCC 25563 |
| 9 | 232693 | 232878 | - | NZ_CP028107.1 | Fusobacterium necrophorum subsp. funduliforme |
| 10 | 1921425 | 1921604 | - | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
| 11 | 241724 | 241903 | + | NZ_CP017253.2 | Clostridium taeniosporum |
| 12 | 3343287 | 3343466 | - | NZ_CP040924.1 | Clostridium thermarum |
| 13 | 5281008 | 5281187 | - | NZ_CP020953.1 | Clostridium drakei |
| 14 | 4643014 | 4643193 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 15 | 1397479 | 1397658 | - | NC_013515.1 | Streptobacillus moniliformis DSM 12112 |
| 16 | 971541 | 971720 | - | NZ_CP071376.1 | Clostridium gasigenes |
| 17 | 4430638 | 4430817 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 18 | 253657 | 253836 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 19 | 2018314 | 2018493 | + | NZ_CP023671.1 | Clostridium septicum |
| 20 | 173515 | 173694 | + | NZ_AP019827.1 | Leptotrichia shahii |
| 21 | 133927 | 134106 | + | NZ_AP019846.1 | Leptotrichia hongkongensis |
| 22 | 2126117 | 2126296 | - | NZ_AP019829.2 | Leptotrichia wadei |
| 23 | 252185 | 252364 | + | NC_013192.1 | Leptotrichia buccalis C-1013-b |
| 24 | 2517256 | 2517435 | - | NZ_AP019845.1 | Leptotrichia trevisanii |
| 25 | 2419603 | 2419782 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 26 | 656561 | 656740 | + | NZ_CP014176.1 | Clostridium argentinense |
| 27 | 222155 | 222334 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 28 | 2188008 | 2188187 | - | NZ_AP019822.1 | Pseudoleptotrichia goodfellowii |
| 29 | 2069985 | 2070164 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 30 | 4437215 | 4437394 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 31 | 244162 | 244341 | + | NC_008593.1 | Clostridium novyi NT |
| 32 | 3669844 | 3670023 | - | NZ_CP028842.1 | Clostridium botulinum |
| 33 | 3950970 | 3951149 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 34 | 202222 | 202401 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 35 | 199265 | 199444 | + | NZ_CP043998.1 | Clostridium diolis |
| 36 | 2605546 | 2605728 | - | NC_015385.1 | Treponema succinifaciens DSM 2489 |
| 37 | 2258615 | 2258794 | - | NZ_LT906477.1 | Clostridium cochlearium |
| 38 | 4552878 | 4553057 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 39 | 2966411 | 2966584 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 40 | 3928822 | 3929001 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 41 | 227328 | 227507 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 42 | 175784 | 175972 | + | NZ_CP007030.1 | Thiomicrospira aerophila AL3 |
| 43 | 287274 | 287453 | + | NZ_CP014204.2 | Clostridium baratii |
| 44 | 571692 | 571877 | + | NC_013861.1 | Legionella longbeachae NSW150 |
| 45 | 140281 | 140469 | + | NC_015581.1 | Thiomicrospira cyclica ALM1 |
| 46 | 2873024 | 2873203 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 47 | 8460 | 8645 | + | NZ_CP025491.2 | Legionella sainthelensi |
| 48 | 6309284 | 6309469 | - | NZ_CP048209.1 | Paenibacillus lycopersici |
| 49 | 3262890 | 3263063 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 50 | 274887 | 275066 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 51 | 2653760 | 2653939 | - | NZ_HG917868.1 | Clostridium bornimense |
| 52 | 4493631 | 4493810 | - | NC_014393.1 | Clostridium cellulovorans 743B |
| 53 | 4226387 | 4226572 | + | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 54 | 5695114 | 5695299 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 55 | 6059549 | 6059734 | + | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 56 | 3529796 | 3529975 | - | NZ_CP030775.1 | Clostridium butyricum |
| 57 | 584037 | 584222 | + | NZ_CP068345.1 | Succinivibrio dextrinosolvens |
| 58 | 221509 | 221694 | - | NZ_CP034437.1 | Paenibacillus albus |
| 59 | 2692213 | 2692371 | - | NC_015500.1 | Treponema brennaborense DSM 12168 |
| 60 | 4635639 | 4635821 | - | NZ_CP031455.1 | Streptomyces olivoreticuli subsp. olivoreticuli |
| 61 | 2393500 | 2393685 | - | NZ_AP021889.1 | Thiosulfatimonas sediminis |
| 62 | 585001 | 585159 | + | NZ_AP021888.1 | Thiosulfativibrio zosterae |
| 63 | 3270243 | 3270425 | - | NZ_CP040752.1 | Streptomyces rectiverticillatus |
| 64 | 2709593 | 2709775 | - | NZ_CP031264.1 | Streptacidiphilus bronchialis |
| 65 | 3080005 | 3080166 | - | NZ_LN614827.1 | Legionella fallonii LLAP-10 |
| 66 | 2795191 | 2795373 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 67 | 4289156 | 4289338 | + | NZ_CP029254.1 | Streptomyces spongiicola |
| 68 | 4061495 | 4061677 | + | NZ_CP029188.1 | Streptomyces tirandamycinicus |
| 69 | 5431679 | 5431861 | + | NZ_CP071139.1 | Streptomyces nojiriensis |
| 70 | 4626651 | 4626833 | + | NZ_CP010849.1 | Streptomyces cyaneogriseus subsp. noncyanogenus |
| 71 | 407156 | 407335 | + | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 72 | 1749 | 1937 | - | NZ_LR134417.1 | Legionella adelaidensis |
| 73 | 3541891 | 3542073 | - | NZ_LN831790.1 | Streptomyces leeuwenhoekii |
| 74 | 370429 | 370587 | + | NZ_CP040602.1 | Thiomicrorhabdus sediminis |
| 75 | 3588784 | 3588966 | - | NZ_CP032698.1 | Streptomyces hundungensis |
| 76 | 5314357 | 5314539 | + | NZ_CP059991.1 | Streptomyces gardneri |
| 77 | 4484853 | 4485035 | + | NZ_CP023698.1 | Streptomyces viridifaciens |
| 78 | 4017515 | 4017697 | - | NZ_CP045643.1 | Streptomyces fagopyri |
| 79 | 387191 | 387361 | + | NZ_AP020335.1 | Hydrogenovibrio marinus |
| 80 | 623819 | 624001 | + | NZ_CP030862.1 | Streptomyces globosus |
| 81 | 2241715 | 2241897 | - | NZ_CP009922.3 | Streptomyces xiamenensis |
| 82 | 2069714 | 2069896 | - | NZ_CP054938.1 | Streptomyces harbinensis |
| 83 | 453741 | 453899 | + | NZ_CP035033.1 | Hydrogenovibrio thermophilus |
| 84 | 5385186 | 5385368 | + | NZ_CP027306.1 | Streptomyces atratus |
| 85 | 4563394 | 4563576 | + | NZ_CP023693.1 | Streptomyces cinereoruber |
| 86 | 643265 | 643417 | + | NZ_CP025682.1 | Azoarcus pumilus |
| 87 | 4606334 | 4606516 | - | NZ_CP070326.1 | Streptomyces noursei |
| 88 | 391398 | 391559 | + | NZ_CP013742.1 | Legionella pneumophila |
| 89 | 2065163 | 2065345 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 90 | 4342791 | 4342973 | + | NZ_CP022310.1 | Streptomyces calvus |
| 91 | 259841 | 260020 | + | NZ_CP016786.1 | Clostridium isatidis |
| 92 | 4613692 | 4613874 | + | NZ_CP029196.1 | Streptomyces venezuelae |
| 93 | 2931150 | 2931332 | - | NZ_CP023202.1 | Streptomyces xinghaiensis S187 |
| 94 | 85845 | 86024 | - | NZ_AP019551.1 | Athalassotoga saccharophila |
| 95 | 2456460 | 2456612 | + | NZ_CP059467.1 | Aromatoleum bremense |
| 96 | 383938 | 384135 | + | NC_012968.1 | Methylotenera mobilis JLW8 |
| 97 | 462176 | 462340 | + | NZ_CP033040.1 | Thiomicrorhabdus indica |
| 98 | 3721753 | 3721935 | - | NZ_CP011340.1 | Streptomyces pristinaespiralis |
| 99 | 3207216 | 3207398 | - | NZ_CP023701.1 | Streptomyces subrutilus |
| 100 | 4888845 | 4889027 | + | NZ_CP020700.1 | Streptomyces tsukubensis |
| 101 | 4753310 | 4753492 | + | NZ_CP042266.1 | Streptomyces qinzhouensis |
| 102 | 779307 | 779468 | + | NC_013959.1 | Sideroxydans lithotrophicus ES-1 |
| 103 | 3881868 | 3882050 | + | NC_016111.1 | Streptomyces cattleya NRRL 8057 = DSM 46488 |
| 104 | 2269478 | 2269630 | + | NC_006513.1 | Aromatoleum aromaticum EbN1 |
| 105 | 3120919 | 3121101 | - | NZ_CP023692.1 | Streptomyces vinaceus |
| 106 | 5209091 | 5209273 | + | NZ_CP023688.1 | Streptomyces rimosus |
| 107 | 2744229 | 2744411 | - | NZ_CP031194.1 | Streptomyces paludis |
| 108 | 1819136 | 1819312 | - | NZ_CP035130.1 | Gudongella oleilytica |
| 109 | 1125678 | 1125851 | + | NC_014960.1 | Anaerolinea thermophila UNI-1 |
| 110 | 2943489 | 2943674 | + | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 111 | 443906 | 444070 | + | NZ_CP054020.1 | Thiomicrorhabdus xiamenensis |
| 112 | 3559767 | 3559949 | - | NZ_CP026652.1 | Streptomyces dengpaensis |
| 113 | 7510057 | 7510239 | + | NC_016582.1 | Streptomyces bingchenggensis BCW-1 |
| 114 | 2645248 | 2645436 | + | NZ_LR134374.1 | Legionella spiritensis |
| 115 | 6475410 | 6475592 | + | NZ_CP065050.1 | Streptomyces solisilvae |
| 116 | 3295825 | 3296007 | - | NZ_CP072827.1 | Streptomyces mobaraensis NBRC 13819 = DSM 40847 |
| 117 | 384569 | 384724 | + | NC_014207.1 | Methylotenera versatilis 301 |
| 118 | 1201857 | 1202027 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 119 | 367640 | 367804 | + | NZ_AP018722.1 | Thiomicrorhabdus aquaedulcis |
| 120 | 2338148 | 2338339 | - | NC_014315.1 | Nitrosococcus watsonii C-113 |
| 121 | 4056304 | 4056459 | - | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 122 | 2656420 | 2656611 | - | NC_007484.1 | Nitrosococcus oceani ATCC 19707 |
| 123 | 5609639 | 5609821 | - | NZ_CP022464.2 | Enterocloster bolteae |
| 124 | 1987262 | 1987441 | + | NZ_LT990039.1 | Massilistercora timonensis |
| 125 | 1308004 | 1308186 | - | NZ_CP027228.1 | Mogibacterium diversum |
| 126 | 2544849 | 2545019 | - | NC_002977.6 | Methylococcus capsulatus str. Bath |
| 127 | 1700098 | 1700274 | + | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 128 | 2909317 | 2909475 | - | NC_017857.3 | Methylophaga nitratireducenticrescens |
| 129 | 329989 | 330144 | + | NC_012969.1 | Methylovorus glucosetrophus SIP3-4 |
| 130 | 2323731 | 2323913 | + | NC_020304.1 | Desulfocapsa sulfexigens DSM 10523 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP028102.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00253.23 | 0.93 | 121 | 1945 | same-strand | Ribosomal protein S14p/S29e |
| 2 | PF00410.21 | 1.0 | 130 | 1519.5 | same-strand | Ribosomal protein S8 |
| 3 | PF00347.25 | 1.0 | 130 | 926.5 | same-strand | Ribosomal protein L6 |
| 4 | PF00861.24 | 0.97 | 126 | 543.0 | same-strand | Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast |
| 5 | PF03719.17 | 1.0 | 130 | 13.0 | same-strand | Ribosomal protein S5, C-terminal domain |
| 6 | PF00333.22 | 1.0 | 130 | 13.0 | same-strand | Ribosomal protein S5, N-terminal domain |
| 7 | PF00828.21 | 0.99 | 129 | 3 | same-strand | Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A |
| 8 | PF00344.22 | 1.0 | 130 | 469.5 | same-strand | SecY |
| 9 | PF00557.26 | 0.62 | 81 | 2580 | same-strand | Metallopeptidase family M24 |
| 10 | PF00406.24 | 0.65 | 85 | 1912 | same-strand | Adenylate kinase |
| 11 | PF13207.8 | 0.65 | 85 | 1912 | same-strand | AAA domain |
| 12 | PF05191.16 | 0.64 | 83 | 1911 | same-strand | Adenylate kinase, active site lid |
++ More..