Result : A0LIJ2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L23 |
| NCBI Accession ID | CP000478.1 |
| Organism | Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) |
| Left | 1918671 |
| Right | 1918964 |
| Strand | + |
| Nucleotide Sequence | ATGAATGAGAAATCGTACCGGATTCTCAAGCGTCCTCTAGTCACTGAAAAGAGCACCACCGAGAAGGATGAGCACAACAAGCTCTTTTTCGAAGTGGACCGCCGGGCGAACAAGATCGAGATCAAGGAGGCGGTGGAGCAGATTTTCAAGGTGGATGTGCTGGATGTGGCGACGATGAATGTCCGGGGGAAGAAGAAGCGCGTCGGCCGTTACTTTACGAAACGAGCCGACCGGAAAAAGGCTATGGTCACGATCAAGCCCGGTCAGCGCGTTGAATTCTTTGAAGGTGTATAG |
| Sequence | MNEKSYRILKRPLVTEKSTTEKDEHNKLFFEVDRRANKIEIKEAVEQIFKVDVLDVATMNVRGKKKRVGRYFTKRADRKKAMVTIKPGQRVEFFEGV |
| Source of smORF | Swiss-Prot |
| Function | One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome. {ECO:0000255|HAMAP-Rule:MF_01369}. |
| Pubmed ID | |
| Domain | CDD:412311 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | A0LIJ2 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 196
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1918671 | 1918964 | + | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 2 | 368009 | 368302 | - | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 3 | 2490633 | 2490887 | - | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 4 | 701595 | 701879 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
| 5 | 3234802 | 3235092 | - | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 6 | 3127624 | 3127893 | - | NC_002939.5 | Geobacter sulfurreducens PCA |
| 7 | 315215 | 315451 | + | NC_007759.1 | Syntrophus aciditrophicus SB |
| 8 | 1207488 | 1207775 | + | NZ_CP061799.1 | Desulfonema limicola |
| 9 | 2597336 | 2597581 | - | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 10 | 2415025 | 2415312 | - | NZ_AP021875.1 | Desulfosarcina widdelii |
| 11 | 842061 | 842318 | + | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
| 12 | 6979817 | 6980104 | + | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 13 | 1047586 | 1047840 | + | NZ_CP061800.1 | Desulfonema magnum |
| 14 | 463179 | 463466 | + | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 15 | 2377577 | 2377864 | - | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 16 | 1657492 | 1657749 | - | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 17 | 1405148 | 1405384 | + | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 18 | 4014790 | 4015074 | - | NC_011979.1 | Geobacter daltonii FRC-32 |
| 19 | 745035 | 745289 | + | NZ_CP009788.1 | Geobacter pickeringii |
| 20 | 1274690 | 1274944 | + | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 21 | 6074945 | 6075235 | + | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 22 | 2936494 | 2936760 | + | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 23 | 650689 | 650979 | - | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
| 24 | 439341 | 439595 | + | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 25 | 470981 | 471235 | + | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 26 | 2961768 | 2962004 | - | NZ_CP045875.1 | Heliorestis convoluta |
| 27 | 2775225 | 2775497 | - | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 28 | 181189 | 181476 | + | NZ_CP034118.1 | Staphylospora marina |
| 29 | 699011 | 699307 | + | NC_016148.1 | Thermovirga lienii DSM 17291 |
| 30 | 501713 | 502000 | + | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 31 | 1171421 | 1171657 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 32 | 471240 | 471536 | + | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 33 | 2244015 | 2244302 | + | NZ_AP018449.1 | Methylomusa anaerophila |
| 34 | 4065235 | 4065522 | - | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 35 | 5496565 | 5496894 | - | NC_013440.1 | Haliangium ochraceum DSM 14365 |
| 36 | 57383 | 57670 | + | NZ_CP036259.1 | Sporomusa termitida |
| 37 | 303859 | 304113 | + | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 38 | 1099345 | 1099629 | + | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 39 | 138005 | 138244 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 40 | 1396640 | 1396924 | + | NC_010814.1 | Geobacter lovleyi SZ |
| 41 | 3686539 | 3686823 | - | NZ_AP023213.1 | Citrifermentans bremense |
| 42 | 2663366 | 2663602 | - | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 43 | 1223454 | 1223750 | - | NC_013522.1 | Thermanaerovibrio acidaminovorans DSM 6589 |
| 44 | 723950 | 724234 | + | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 45 | 3318211 | 3318450 | - | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 46 | 2496256 | 2496546 | - | NZ_CP017237.1 | Moorella thermoacetica |
| 47 | 1081887 | 1082165 | + | NZ_CP035108.1 | Geovibrio thiophilus |
| 48 | 163744 | 164034 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 49 | 1195263 | 1195559 | + | NC_010162.1 | Sorangium cellulosum So ce56 |
| 50 | 1783699 | 1783947 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 51 | 2345291 | 2345548 | - | NZ_CP012332.1 | Vulgatibacter incomptus |
| 52 | 2485419 | 2485724 | + | NZ_CP012159.1 | Chondromyces crocatus |
| 53 | 1640607 | 1640888 | - | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 54 | 1555722 | 1556000 | - | NC_014758.1 | Calditerrivibrio nitroreducens DSM 19672 |
| 55 | 240107 | 240394 | + | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 56 | 1403454 | 1403693 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 57 | 374152 | 374403 | + | NC_014836.1 | Desulfurispirillum indicum S5 |
| 58 | 238834 | 239121 | + | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 59 | 3111022 | 3111276 | - | NZ_CP010802.1 | Desulfuromonas soudanensis |
| 60 | 9028635 | 9028931 | - | NZ_CP016211.1 | Minicystis rosea |
| 61 | 138245 | 138535 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 62 | 407465 | 407752 | + | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 63 | 1674039 | 1674323 | - | NZ_LT906470.1 | Veillonella rodentium |
| 64 | 1616290 | 1616574 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 65 | 1672886 | 1673170 | - | NZ_LR134375.1 | Veillonella dispar |
| 66 | 1732556 | 1732840 | - | NZ_LR778174.1 | Veillonella parvula |
| 67 | 321049 | 321306 | + | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
| 68 | 1039247 | 1039486 | - | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 69 | 854558 | 854812 | + | NC_007498.2 | Syntrophotalea carbinolica DSM 2380 |
| 70 | 2259110 | 2259346 | - | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 71 | 1097973 | 1098263 | + | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 72 | 441833 | 442069 | + | NZ_AP022873.1 | Dissulfurispira thermophila |
| 73 | 5223954 | 5224238 | - | NC_009767.1 | Roseiflexus castenholzii DSM 13941 |
| 74 | 345077 | 345313 | + | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 75 | 2007052 | 2007300 | + | NZ_LT996885.1 | Dialister massiliensis |
| 76 | 233484 | 233738 | + | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 77 | 2071902 | 2072138 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 78 | 305569 | 305823 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 79 | 170401 | 170691 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 80 | 1867299 | 1867595 | + | NZ_CP042829.1 | Tepidiforma bonchosmolovskayae |
| 81 | 2590688 | 2590981 | - | NZ_AP019309.1 | Intestinibaculum porci |
| 82 | 3758050 | 3758289 | - | NC_014624.2 | Eubacterium callanderi |
| 83 | 2165340 | 2165579 | - | NZ_CP029487.1 | Eubacterium maltosivorans |
| 84 | 1377887 | 1378126 | + | NZ_CP019962.1 | Eubacterium limosum |
| 85 | 558064 | 558351 | + | NZ_CP046996.1 | Dehalobacter restrictus |
| 86 | 5702114 | 5702404 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 87 | 692518 | 692754 | + | NZ_LT635772.1 | Anaerococcus mediterraneensis |
| 88 | 152918 | 153208 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 89 | 3720444 | 3720683 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 90 | 3450598 | 3450888 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 91 | 1398361 | 1398651 | + | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 92 | 387613 | 387867 | + | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 93 | 241328 | 241579 | + | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 94 | 215307 | 215546 | + | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 95 | 3679500 | 3679763 | - | NC_011831.1 | Chloroflexus aggregans DSM 9485 |
| 96 | 145411 | 145698 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 97 | 1679780 | 1680019 | + | NZ_AP014945.1 | Caldimicrobium thiodismutans |
| 98 | 633751 | 633990 | + | NZ_CP009761.1 | Parvimonas micra |
| 99 | 1628259 | 1628549 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 100 | 1143204 | 1143488 | + | NZ_CP053187.1 | Turicibacter sanguinis |
| 101 | 1129255 | 1129515 | - | NZ_CP048429.1 | Paenibacillus jilunlii |
| 102 | 6435925 | 6436185 | - | NZ_CP009287.1 | Paenibacillus graminis |
| 103 | 1151580 | 1151840 | - | NZ_CP068595.1 | Paenibacillus sonchi |
| 104 | 2748876 | 2749118 | - | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 105 | 4212092 | 4212367 | - | NZ_CP020569.1 | Streptomyces gilvosporeus |
| 106 | 4182411 | 4182650 | - | NZ_CP020559.1 | Clostridium formicaceticum |
| 107 | 5020287 | 5020547 | - | NZ_CP009286.1 | Paenibacillus stellifer |
| 108 | 354699 | 354935 | + | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 109 | 2256120 | 2256356 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 110 | 2316424 | 2316711 | + | NC_020304.1 | Desulfocapsa sulfexigens DSM 10523 |
| 111 | 6282624 | 6282884 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 112 | 747802 | 748041 | + | NC_015682.1 | Thermodesulfobacterium geofontis OPF15 |
| 113 | 51070 | 51357 | - | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 114 | 1216012 | 1216248 | - | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 115 | 1813024 | 1813260 | - | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 116 | 1003689 | 1003925 | + | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 117 | 2403800 | 2404036 | - | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 118 | 675479 | 675736 | + | NZ_CP036250.1 | Egicoccus halophilus |
| 119 | 1038905 | 1039141 | + | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 120 | 1146269 | 1146505 | + | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 121 | 1819299 | 1819535 | - | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 122 | 55507 | 55794 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 123 | 7400798 | 7401058 | - | NZ_CP009285.1 | Paenibacillus borealis |
| 124 | 6157632 | 6157892 | - | NZ_CP009428.1 | Paenibacillus odorifer |
| 125 | 1279694 | 1279969 | + | NZ_CP027770.1 | Staphylococcus felis |
| 126 | 4690671 | 4690931 | - | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 127 | 5297740 | 5298000 | - | NZ_CP009288.1 | Paenibacillus durus |
| 128 | 5780699 | 5780989 | - | NZ_CP015136.1 | Luteitalea pratensis |
| 129 | 1568027 | 1568266 | - | NZ_CP047141.1 | Ligilactobacillus animalis |
| 130 | 314554 | 314790 | + | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 131 | 974998 | 975234 | + | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 132 | 1788646 | 1788903 | + | NZ_CP021434.1 | Tumebacillus avium |
| 133 | 158118 | 158408 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 134 | 3077390 | 3077641 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 135 | 4642927 | 4643187 | - | NZ_CP031455.1 | Streptomyces olivoreticuli subsp. olivoreticuli |
| 136 | 1980149 | 1980424 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 137 | 3500636 | 3500896 | - | NZ_CP060404.1 | Streptomyces buecherae |
| 138 | 2174185 | 2174427 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 139 | 1373243 | 1373530 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 140 | 1635681 | 1635938 | + | NZ_CP034248.1 | Paenibacillus lentus |
| 141 | 142634 | 142891 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 142 | 4388037 | 4388297 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 143 | 129110 | 129400 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 144 | 148860 | 149147 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 145 | 651627 | 651902 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 146 | 2541988 | 2542275 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 147 | 1061995 | 1062282 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 148 | 416040 | 416276 | + | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 149 | 431761 | 432027 | + | NZ_CP017560.1 | Sporosarcina ureilytica |
| 150 | 2292914 | 2293150 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 151 | 131673 | 131960 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 152 | 311702 | 311995 | + | NC_019897.1 | Thermobacillus composti KWC4 |
| 153 | 1983704 | 1983979 | + | NZ_CP065729.1 | Macrococcus caseolyticus |
| 154 | 239383 | 239658 | + | NZ_CP047361.1 | Macrococcus canis |
| 155 | 4369137 | 4369394 | - | NZ_CP022657.1 | Tumebacillus algifaecis |
| 156 | 1728916 | 1729191 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 157 | 7136848 | 7137108 | - | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 158 | 3983741 | 3984001 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 159 | 121222 | 121509 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 160 | 129335 | 129574 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 161 | 2814163 | 2814423 | - | NZ_CP048882.1 | Streptomyces bathyalis |
| 162 | 9217457 | 9217720 | - | NZ_CP007155.1 | Kutzneria albida DSM 43870 |
| 163 | 1942417 | 1942653 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 164 | 2013261 | 2013497 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 165 | 938274 | 938516 | + | NZ_CP067016.1 | Anaerococcus obesiensis |
| 166 | 322973 | 323215 | + | NZ_CP066014.1 | Anaerococcus vaginalis |
| 167 | 1769971 | 1770246 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 168 | 705695 | 705970 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 169 | 348791 | 349027 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 170 | 4737088 | 4737375 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 171 | 271418 | 271663 | + | NZ_CP031835.1 | Lactobacillus amylolyticus |
| 172 | 3265783 | 3266019 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 173 | 790063 | 790350 | + | NZ_CP014872.1 | Fructilactobacillus lindneri |
| 174 | 3622926 | 3623216 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 175 | 167583 | 167870 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 176 | 1523035 | 1523274 | - | NZ_LT906446.1 | Megamonas hypermegale |
| 177 | 1549273 | 1549521 | - | NZ_CP015444.1 | Lactobacillus helveticus |
| 178 | 625557 | 625859 | + | NZ_CP012117.1 | Dermabacter vaginalis |
| 179 | 403509 | 403748 | + | NZ_CP018809.1 | Lactobacillus jensenii |
| 180 | 398995 | 399282 | + | NZ_CP045562.1 | Fructilactobacillus fructivorans |
| 181 | 395276 | 395524 | + | NZ_CP059829.1 | Lactobacillus ultunensis |
| 182 | 334693 | 334932 | + | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 183 | 337640 | 337879 | + | NZ_AP018549.1 | Lactobacillus paragasseri |
| 184 | 1101164 | 1101451 | - | NZ_CP045563.1 | Fructilactobacillus sanfranciscensis |
| 185 | 339398 | 339637 | + | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 186 | 1320317 | 1320556 | - | NZ_CP045530.1 | Limosilactobacillus pontis |
| 187 | 807972 | 808211 | - | NZ_CP042374.1 | Leuconostoc carnosum |
| 188 | 292285 | 292530 | + | NC_021181.2 | Lactobacillus acidophilus La-14 |
| 189 | 355497 | 355745 | + | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
| 190 | 1513139 | 1513375 | - | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 191 | 1719617 | 1719922 | + | NZ_LT635457.1 | Actinomyces pacaensis |
| 192 | 1142955 | 1143215 | + | NC_012440.1 | Persephonella marina EX-H1 |
| 193 | 1566911 | 1567150 | - | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 194 | 1760007 | 1760306 | - | NZ_CP044548.2 | Janibacter melonis |
| 195 | 576330 | 576581 | + | NZ_CP013290.1 | Janibacter indicus |
| 196 | 4435471 | 4435770 | - | NZ_CP011112.1 | Luteipulveratus mongoliensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_014365.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00009.29 | 0.75 | 147 | 2243 | same-strand | Elongation factor Tu GTP binding domain |
| 2 | PF03143.19 | 0.67 | 131 | 1862 | same-strand | Elongation factor Tu C-terminal domain |
| 3 | PF03144.27 | 0.75 | 147 | 2217 | same-strand | Elongation factor Tu domain 2 |
| 4 | PF01926.25 | 0.69 | 135 | 1926 | same-strand | 50S ribosome-binding GTPase |
| 5 | PF00338.24 | 0.99 | 195 | 1348 | same-strand | Ribosomal protein S10p/S20e |
| 6 | PF00573.24 | 0.99 | 195 | 33 | same-strand | Ribosomal protein L4/L1 family |
| 7 | PF03947.20 | 0.99 | 195 | 28 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 8 | PF00181.25 | 0.99 | 195 | 28 | same-strand | Ribosomal Proteins L2, RNA binding domain |
| 9 | PF00203.23 | 0.99 | 195 | 898 | same-strand | Ribosomal protein S19 |
| 10 | PF00237.21 | 0.96 | 189 | 1208 | same-strand | Ribosomal protein L22p/L17e |
| 11 | PF00189.22 | 0.98 | 192 | 1562.0 | same-strand | Ribosomal protein S3, C-terminal domain |
| 12 | PF07650.19 | 0.98 | 192 | 1562.0 | same-strand | KH domain |
| 13 | PF00252.20 | 0.97 | 191 | 2232 | same-strand | Ribosomal protein L16p/L10e |
| 14 | PF03764.20 | 0.61 | 119 | 3059 | same-strand | Elongation factor G, domain IV |
| 15 | PF00679.26 | 0.61 | 119 | 3059 | same-strand | Elongation factor G C-terminus |
| 16 | PF14492.8 | 0.61 | 119 | 3059 | same-strand | Elongation Factor G, domain III |
++ More..