Protein Information |
Information Type | Description |
---|---|
Protein name | Putative septation protein SpoVG |
NCBI Accession ID | AE009951.2 |
Organism | Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355) |
Left | 660930 |
Right | 661211 |
Strand | + |
Nucleotide Sequence | ATGAAAGTTACAAATGTAAAAATTAAAAAAGTTGATGGAGATAAGTTTGATAGACTAAGAGCATATGTTGATGTAACACTTGATGATTGCTTAGTTATTCATGGTTTGAAATTGATGCAAGGAGAACAAGGTATGTTTGTAGCTATGCCATCGAGAAAAATGCGTAATGAAGAGTTTAAAGATATTGTTCACCCTATATGTCCTGAATTAAGAAATGATATTACAAAAGTAGTTCAAGAAAAATACTTTGCATTGGATCAAGAACAAGAAGCAGTAATTTAG |
Sequence | MKVTNVKIKKVDGDKFDRLRAYVDVTLDDCLVIHGLKLMQGEQGMFVAMPSRKMRNEEFKDIVHPICPELRNDITKVVQEKYFALDQEQEAVI |
Source of smORF | Swiss-Prot |
Function | Could be involved in septation. {ECO:0000255|HAMAP-Rule:MF_00819}. |
Pubmed ID | 11889109 |
Domain | CDD:412646 |
Functional Category | Others |
Uniprot ID | Q8RH88 |
ORF Length (Amino Acid) | 93 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 245059 | 245340 | + | NZ_CP068114.1 | Fusobacterium canifelinum |
2 | 2363892 | 2364173 | + | NZ_LN831027.1 | Fusobacterium nucleatum subsp. polymorphum |
3 | 321497 | 321775 | + | NZ_CP013336.1 | Fusobacterium hwasookii ChDC F206 |
4 | 1425901 | 1426185 | - | NZ_CP024699.1 | Fusobacterium pseudoperiodonticum |
5 | 288610 | 288894 | + | NZ_CP028106.1 | Fusobacterium gonidiaformans ATCC 25563 |
6 | 294537 | 294824 | - | NZ_CP028107.1 | Fusobacterium necrophorum subsp. funduliforme |
7 | 2004544 | 2004828 | - | NZ_AP019827.1 | Leptotrichia shahii |
8 | 2430468 | 2430746 | - | NC_013192.1 | Leptotrichia buccalis C-1013-b |
9 | 496086 | 496367 | - | NZ_CP028102.1 | Fusobacterium mortiferum ATCC 9817 |
10 | 25515 | 25790 | + | NZ_AP019822.1 | Pseudoleptotrichia goodfellowii |
11 | 1043707 | 1043997 | + | NZ_CP028103.1 | Fusobacterium varium ATCC 27725 |
12 | 2033589 | 2033879 | - | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
13 | 2133421 | 2133705 | - | NZ_AP019846.1 | Leptotrichia hongkongensis |
14 | 158901 | 159185 | + | NZ_AP019829.2 | Leptotrichia wadei |
15 | 1374924 | 1375217 | + | NZ_CP028105.1 | Fusobacterium ulcerans |
16 | 19383 | 19667 | + | NZ_AP019845.1 | Leptotrichia trevisanii |
17 | 1958330 | 1958608 | - | NC_015385.1 | Treponema succinifaciens DSM 2489 |
18 | 90104 | 90382 | - | NZ_LR215048.1 | Acholeplasma axanthum |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00270.31 | 0.72 | 13 | 1757 | same-strand | DEAD/DEAH box helicase |
2 | PF17757.3 | 0.72 | 13 | 1757 | same-strand | UvrB interaction domain |
3 | PF03461.17 | 0.72 | 13 | 1757 | same-strand | TRCF domain |
4 | PF00271.33 | 0.72 | 13 | 1757 | same-strand | Helicase conserved C-terminal domain |
5 | PF02559.18 | 0.72 | 13 | 1757 | same-strand | CarD-like/TRCF domain |
6 | PF04851.17 | 0.72 | 13 | 1757 | same-strand | Type III restriction enzyme, res subunit |
7 | PF01479.27 | 0.89 | 16 | 881.0 | same-strand | S4 domain |