Protein Information |
Information Type | Description |
---|---|
Protein name | Cell division topological specificity factor |
NCBI Accession ID | AE009951.2 |
Organism | Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355) |
Left | 802097 |
Right | 802396 |
Strand | + |
Nucleotide Sequence | GTGGGTTTTTTTAGTAATTTTTTCAAAAAAGAAAATTCAAAAGATGATGCAAAAAATAGATTGAAGTTAGTTTTAATCCAAGATAGAGCAATGCTTCCATCTGGTGTTTTAGAAAATATGAAAGATGATATTTTAAAAGTTTTATCTAAATATGTTGAGATTGAAAAATCTAAATTAAATATAGAAATGTGTCCTTATGAAGACGATCCTAGAAAAATTGCATTAGTAGCTAATATTCCAATCTTAAAGTCAAGTACTAGGGAAGTAACAAAAACAACAAAACAACAAAAACGTAAGTAA |
Sequence | MGFFSNFFKKENSKDDAKNRLKLVLIQDRAMLPSGVLENMKDDILKVLSKYVEIEKSKLNIEMCPYEDDPRKIALVANIPILKSSTREVTKTTKQQKRK |
Source of smORF | Swiss-Prot |
Function | Prevents the cell division inhibition by proteins MinC and MinD at internal division sites while permitting inhibition at polar sites. This ensures cell division at the proper site by restricting the formation of a division septum at the midpoint of the long axis of the cell. {ECO:0000255|HAMAP-Rule:MF_00262}. |
Pubmed ID | 11889109 |
Domain | CDD:412433 |
Functional Category | Others |
Uniprot ID | Q8RGV0 |
ORF Length (Amino Acid) | 99 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 723074 | 723376 | + | NZ_CP068114.1 | Fusobacterium canifelinum |
2 | 66715 | 66999 | - | NZ_CP013336.1 | Fusobacterium hwasookii ChDC F206 |
3 | 617484 | 617747 | + | NZ_LN831027.1 | Fusobacterium nucleatum subsp. polymorphum |
4 | 1951658 | 1951927 | + | NZ_CP024699.1 | Fusobacterium pseudoperiodonticum |
5 | 7660 | 7914 | - | NZ_CP028107.1 | Fusobacterium necrophorum subsp. funduliforme |
6 | 548499 | 548756 | + | NZ_CP028106.1 | Fusobacterium gonidiaformans ATCC 25563 |
7 | 629944 | 630216 | - | NZ_CP028103.1 | Fusobacterium varium ATCC 27725 |
8 | 1480067 | 1480330 | - | NZ_CP028102.1 | Fusobacterium mortiferum ATCC 9817 |
9 | 1913073 | 1913342 | + | NZ_CP028105.1 | Fusobacterium ulcerans |
10 | 1288148 | 1288405 | - | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
11 | 3057676 | 3057942 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
12 | 808058 | 808324 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
13 | 3373066 | 3373332 | - | NC_014393.1 | Clostridium cellulovorans 743B |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03775.18 | 1.0 | 13 | 817 | same-strand | Septum formation inhibitor MinC, C-terminal domain |
2 | PF13614.8 | 1.0 | 13 | 8 | same-strand | AAA domain |
3 | PF01656.25 | 1.0 | 13 | 8 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
4 | PF10609.11 | 1.0 | 13 | 8 | same-strand | NUBPL iron-transfer P-loop NTPase |