Result : Q8RDR9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L28 |
| NCBI Accession ID | AE009951.2 |
| Organism | Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355) |
| Left | 2105980 |
| Right | 2106237 |
| Strand | - |
| Nucleotide Sequence | ATGCAAAGATGTGAAATCACAGGAACTGGTTTAATTAGTGGAAACCAAATATCTCACTCTCATAGATTAACTAGAAGAGTATGGAAACCAAACCTACAAGTTACAACTTTAGTTGTTAATGGTAGCCCAATAAAAGTAAAAGTTTGTGCTAGAACTTTAAAAACTTTAAAAGGAGCTTCTGAAGTAGAAGTAATGAGAATTTTAAAAGCAAATATTGCTACTTTAAGTGAAAGATTATTAAAACACTTAAACAAATAA |
| Sequence | MQRCEITGTGLISGNQISHSHRLTRRVWKPNLQVTTLVVNGSPIKVKVCARTLKTLKGASEVEVMRILKANIATLSERLLKHLNK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00367. Profile Description: Ribosomal L28 family. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture (e.g. SP|P36525 from Saccharomyces cerevisiae, which is 258 amino acids long) and are not included. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 11889109 |
| Domain | CDD:412338 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q8RDR9 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 11
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2075504 | 2075761 | - | NZ_LN831027.1 | Fusobacterium nucleatum subsp. polymorphum |
| 2 | 984849 | 985106 | + | NZ_CP013336.1 | Fusobacterium hwasookii ChDC F206 |
| 3 | 2132717 | 2132974 | - | NZ_CP068114.1 | Fusobacterium canifelinum |
| 4 | 1708958 | 1709215 | + | NZ_CP024699.1 | Fusobacterium pseudoperiodonticum |
| 5 | 1109822 | 1110079 | - | NZ_CP028103.1 | Fusobacterium varium ATCC 27725 |
| 6 | 1429734 | 1429991 | - | NZ_CP028105.1 | Fusobacterium ulcerans |
| 7 | 215661 | 215918 | + | NZ_CP028106.1 | Fusobacterium gonidiaformans ATCC 25563 |
| 8 | 377517 | 377774 | - | NZ_CP028107.1 | Fusobacterium necrophorum subsp. funduliforme |
| 9 | 443934 | 444191 | + | NZ_CP028102.1 | Fusobacterium mortiferum ATCC 9817 |
| 10 | 1967708 | 1967965 | + | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
| 11 | 1934071 | 1934334 | + | NZ_AP019822.1 | Pseudoleptotrichia goodfellowii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP028103.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00488.23 | 0.64 | 7 | 170 | opposite-strand | MutS domain V |
| 2 | PF01713.23 | 0.64 | 7 | 170 | opposite-strand | Smr domain |
| 3 | PF01406.21 | 0.64 | 7 | 5273 | opposite-strand | tRNA synthetases class I (C) catalytic domain |
| 4 | PF09190.13 | 0.64 | 7 | 5273 | opposite-strand | DALR domain |
++ More..