Result : Q8RCT2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein Tlp homolog |
| NCBI Accession ID | AE008691.1 |
| Organism | Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) |
| Left | 346436 |
| Right | 346690 |
| Strand | - |
| Nucleotide Sequence | ATGGGAAAAGAAGAAAGATATACAAAAAAGCCAAAGCCTGATGATAGGTCAGACAATGTGGAAAAGCTTCAAGAAATGATACACAATACAATAGAAAATTATAGAGAAGCAGAAGATTATCTGAAACTACACGCAGAAGAGCTTTCACCTGAAGAAATAGAGAGGATAAAAGAAAAAAATAGAAACAGGCTTATAAGCATACAGAACATGCGTCAGGAAATAATTGACGAGGTCCATGACAGAGAAAGAAGGTAA |
| Sequence | MGKEERYTKKPKPDDRSDNVEKLQEMIHNTIENYREAEDYLKLHAEELSPEEIERIKEKNRNRLISIQNMRQEIIDEVHDRERR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl07951. Profile Description: N/A. This protein family is restricted to a subset of endospore-forming bacteria such as Bacillus subtilis, all of which are in the Firmicutes (low-GC Gram-positive) lineage. Although previously designated tlp (thioredoxin-like protein), the B. subtilis protein was shown to be a minor small acid-soluble spore protein SASP, unique to spores. The motif E[VIL]XDE near the C-terminus probably represents at a germination protease cleavage site. [Cellular processes, Sporulation and germination] |
| Pubmed ID | 11997336 |
| Domain | CDD:186720 |
| Functional Category | Others |
| Uniprot ID | Q8RCT2 |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 69
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 346436 | 346690 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 2 | 284268 | 284525 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 3 | 332236 | 332493 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 4 | 1998207 | 1998464 | + | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 5 | 383639 | 383908 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 6 | 396742 | 397005 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 7 | 2078472 | 2078741 | + | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 8 | 460595 | 460804 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 9 | 2362300 | 2362569 | + | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 10 | 3098810 | 3099034 | - | NZ_CP034248.1 | Paenibacillus lentus |
| 11 | 1599772 | 1599999 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 12 | 1795035 | 1795259 | + | NZ_CP033433.1 | Cohnella candidum |
| 13 | 777356 | 777583 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 14 | 1078393 | 1078620 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 15 | 2453929 | 2454162 | - | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 16 | 2410738 | 2410959 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 17 | 2341150 | 2341377 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 18 | 1782689 | 1782916 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 19 | 1092669 | 1092890 | - | NZ_CP019699.1 | Novibacillus thermophilus |
| 20 | 1962083 | 1962316 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 21 | 2378098 | 2378331 | - | NZ_LS483476.1 | Lederbergia lentus |
| 22 | 3461522 | 3461752 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 23 | 2167287 | 2167532 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 24 | 375052 | 375282 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 25 | 1779135 | 1779365 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 26 | 2871177 | 2871410 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 27 | 4074762 | 4074986 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 28 | 1892527 | 1892778 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 29 | 198671 | 198895 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 30 | 3647711 | 3647938 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 31 | 1838760 | 1839014 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 32 | 1857651 | 1857902 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 33 | 3378608 | 3378835 | + | NZ_CP035485.1 | Salicibibacter halophilus |
| 34 | 1894333 | 1894584 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 35 | 1967725 | 1967952 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 36 | 1930447 | 1930698 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 37 | 2524011 | 2524253 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 38 | 3291878 | 3292105 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 39 | 39696 | 39947 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 40 | 2076103 | 2076345 | - | NZ_CP011937.1 | Bacillus velezensis |
| 41 | 5528622 | 5528846 | + | NZ_CP009286.1 | Paenibacillus stellifer |
| 42 | 3946081 | 3946314 | - | NZ_CP053989.1 | Niallia circulans |
| 43 | 1879486 | 1879728 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 44 | 3642016 | 3642246 | + | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 45 | 612511 | 612735 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 46 | 4622241 | 4622483 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 47 | 2037859 | 2038086 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 48 | 2172947 | 2173186 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 49 | 2040359 | 2040595 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 50 | 1883207 | 1883428 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 51 | 1687673 | 1687903 | - | NZ_CP012024.1 | Bacillus smithii |
| 52 | 1444835 | 1445059 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 53 | 1779861 | 1780103 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 54 | 3545707 | 3545949 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 55 | 1825881 | 1826114 | + | NC_019897.1 | Thermobacillus composti KWC4 |
| 56 | 2431993 | 2432232 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 57 | 1989775 | 1990011 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 58 | 620547 | 620771 | - | NZ_CP009288.1 | Paenibacillus durus |
| 59 | 1751423 | 1751638 | - | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 60 | 2065423 | 2065650 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 61 | 847830 | 848054 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 62 | 3058633 | 3058854 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 63 | 4739702 | 4739926 | - | NZ_CP020028.1 | Paenibacillus kribbensis |
| 64 | 1940534 | 1940749 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 65 | 1542405 | 1542620 | - | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 66 | 1963920 | 1964135 | - | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 67 | 3040598 | 3040813 | + | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 68 | 2185501 | 2185737 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 69 | 3134363 | 3134587 | + | NZ_CP045298.1 | Paenibacillus brasilensis |
++ More..