| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Small, acid-soluble spore protein I (SASP I) |
| NCBI Accession ID | AE008691.1 |
| Organism | Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) |
| Left | 1001518 |
| Right | 1001718 |
| Strand | + |
| Nucleotide Sequence | ATGGACATAAAAAGAGCTGTATTGGAAAATTTAAAGAGAAGGTCAAAAGAAGAAATAAAAGGTTTTATTCAGGAGGTGGTGGACAGCAAAAATGAAAATGCAATTCCCGGACTGGGGGTGATATTTGAAGCTGCATGGGAGAAAATGACTGAAGAGGAGAAGGACAGCATGATGAACCTGATAATGAGGGGGATATCTTGA |
| Sequence | MDIKRAVLENLKRRSKEEIKGFIQEVVDSKNENAIPGLGVIFEAAWEKMTEEEKDSMMNLIMRGIS |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl07940. Profile Description: Small, acid-soluble spore protein I. small acid-soluble spore protein SspI; Provisional |
| Pubmed ID | 11997336 |
| Domain | CDD:415450 |
| Functional Category | Others |
| Uniprot ID | Q8RB27 |
| ORF Length (Amino Acid) | 66 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1001518 | 1001718 | + | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 2 | 1016656 | 1016856 | + | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 3 | 1041361 | 1041561 | + | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 4 | 1123493 | 1123693 | + | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 5 | 1027321 | 1027521 | + | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 6 | 1013973 | 1014173 | + | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 7 | 1638732 | 1638932 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 8 | 1632881 | 1633081 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 9 | 1173652 | 1173852 | + | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01661.23 | 1.0 | 9 | 1350 | same-strand | Macro domain |
| 2 | PF02673.20 | 1.0 | 9 | 503 | opposite-strand | Bacitracin resistance protein BacA |
| 3 | PF07441.13 | 0.89 | 8 | 82.5 | same-strand | SigmaK-factor processing regulatory protein BofA |
| 4 | PF19583.1 | 0.89 | 8 | 1727.5 | same-strand | ODP family beta lactamase |