ProsmORF-pred
Result : Q8R961
Protein Information
Information Type Description
Protein name Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase)
NCBI Accession ID AE008691.1
Organism Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis)
Left 1713010
Right 1713282
Strand -
Nucleotide Sequence ATGAAAAAGACTGTTCATTTGAGGATAACTGGACATGTCCAGGGAGTGGGGCTCAGGTATTCTGTGTATCAGAAGGCTACGTCTCTTGGAATTACGGGCTATGCAGAGAATTTGTACGATGGAAGTGTTGAAGTGGTAGCAGAAGGGGATGAGGAGAGCATAAAGGAGCTCATACATTTTATCAAGACAGGCTTGAGGTGGGCAAGAGTGGATAACGTGGAGGAGAGATGGTTAGAGTATAAAGGTCAGTACAAAGATTTTCGCATTTATTGA
Sequence MKKTVHLRITGHVQGVGLRYSVYQKATSLGITGYAENLYDGSVEVVAEGDEESIKELIHFIKTGLRWARVDNVEERWLEYKGQYKDFRIY
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional
Pubmed ID 11997336
Domain CDD:412440
Functional Category Others
Uniprot ID Q8R961
ORF Length (Amino Acid) 90
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 50
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1713010 1713282 - NC_003869.1 Caldanaerobacter subterraneus subsp. tengcongensis MB4
2 772221 772493 + NC_014964.1 Thermoanaerobacter brockii subsp. finnii Ako-1
3 1694071 1694343 - NC_015958.1 Thermoanaerobacter wiegelii Rt8.B1
4 1555249 1555521 - NC_014209.1 Thermoanaerobacter mathranii subsp. mathranii str. A3
5 1573932 1574204 - NC_013921.1 Thermoanaerobacter italicus Ab9
6 1562776 1563048 - NZ_CP009170.1 Thermoanaerobacter kivui
7 2018061 2018333 - NC_014410.1 Thermoanaerobacterium thermosaccharolyticum DSM 571
8 859147 859419 + NC_015555.1 Thermoanaerobacterium xylanolyticum LX-11
9 773590 773862 + NZ_CP047602.1 Thermoanaerobacterium aotearoense
10 668924 669199 + NC_014377.1 Thermosediminibacter oceani DSM 16646
11 1212067 1212342 + NC_015519.1 Tepidanaerobacter acetatoxydans Re1
12 769275 769550 + NC_017096.1 Caldisericum exile AZM16c01
13 2154333 2154605 - NZ_CP020477.1 Acidianus manzaensis
14 1790448 1790720 - NZ_CP029288.2 Acidianus sulfidivorans JP7
15 93966 94247 + NZ_CP007493.1 Thermofilum adornatus 1505
16 465388 465654 + NZ_CP016312.1 Thermus brockianus
17 2380764 2381036 - NZ_CP077717.1 Saccharolobus shibatae B12
18 1660429 1660701 + NZ_CP033238.1 Saccharolobus solfataricus
19 1265912 1266178 + NZ_CP010822.1 Thermus aquaticus Y51MC23
20 35519 35785 + NC_022084.1 Thermococcus litoralis DSM 5473
21 733469 733735 - NC_019386.1 Thermus oshimai JL-2
22 1643552 1643779 - NC_000868.1 Pyrococcus abyssi GE5
23 270758 271033 + NC_000961.1 Pyrococcus horikoshii OT3
24 528666 528932 - NC_006461.1 Thermus thermophilus HB8
25 1448572 1448838 + NZ_CP014141.1 Thermus parvatiensis
26 276885 277160 + NZ_CP023154.1 Pyrococcus furiosus DSM 3638
27 113118 113384 - NZ_CP038452.1 Thermus caldilimi
28 174596 174871 - NZ_CP010835.1 Pyrococcus kukulkanii
29 456508 456783 + NZ_LN999010.1 Thermococcus chitonophagus
30 1319368 1319643 - NC_014804.1 Thermococcus barophilus MP
31 141541 141771 - NC_012691.1 Tolumonas auensis DSM 9187
32 330048 330323 - NC_012804.1 Thermococcus gammatolerans EJ3
33 293738 293965 + NZ_CP008887.1 Thermococcus eurythermalis
34 142527 142802 + NZ_LT900021.1 Thermococcus henrietii
35 1737090 1737320 + NZ_CP050150.1 Hafnia alvei
36 1598135 1598398 + NZ_CP012264.1 Cronobacter condimenti 1330
37 1696887 1697165 + NZ_LR134340.1 Escherichia marmotae
38 1811969 1812247 + NZ_CP012024.1 Bacillus smithii
39 1104072 1104335 + NZ_CP021081.1 Deinococcus ficus
40 1041706 1041984 + NZ_AP014857.1 Escherichia albertii
41 1017987 1018265 + NC_004337.2 Shigella flexneri 2a str. 301
42 6087248 6087502 - NZ_CP007142.1 Gynuella sunshinyii YC6258
43 372593 372832 - NC_016070.1 Thermoproteus tenax Kra 1
44 1813138 1813383 - NZ_CP045769.1 Enterobacter cancerogenus
45 3217235 3217468 - NZ_CP023525.1 Cedecea neteri
46 3110067 3110318 + NZ_CP007044.2 Chania multitudinisentens RB-25
47 2522400 2522681 - NC_017910.1 Shimwellia blattae DSM 4481 = NBRC 105725
48 4072214 4072453 + NZ_CP011254.1 Serratia fonticola
49 2996337 2996570 - NZ_LR134201.1 Cedecea lapagei
50 1230648 1230920 - NC_011297.1 Dictyoglomus thermophilum H-6-12
++ More..