Protein Information |
Information Type | Description |
---|---|
Protein name | Putative ribosomal protein L7Ae-like |
NCBI Accession ID | AE008691.1 |
Organism | Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) |
Left | 2180522 |
Right | 2180770 |
Strand | - |
Nucleotide Sequence | ATGGCGGAACAATGCCCTCCCAAAAGGGTGGTTGGGGCTAAACAGACTTTAAAAGCAGTGTTAAACTGCAAAGTAGCTCAGGTGTACATTGCAAAGGATGCAGAAGAGCATGTGGTCAAAAAGATAAAAGAAGCGTGCGAAGAAAAGGGTATAAAAATAGTTTACATTGATACTATGAAAGAGCTTGGCAGGATGTGCGGTATTGATGTAGGTGCTGCCACTGCGGCAGATGTAATAGGGGAAAGATAA |
Sequence | MAEQCPPKRVVGAKQTLKAVLNCKVAQVYIAKDAEEHVVKKIKEACEEKGIKIVYIDTMKELGRMCGIDVGAATAADVIGER |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00600. Profile Description: Ribosomal protein L7Ae/L30e/S12e/Gadd45 family. This RNA binding Pelota domain is at the C-terminus of a PRTase family. These PRTase+Pelota genes are found in the biosynthetic operon associated with the Ter stress-response operon and are predicted to be involved in the biosynthesis of a ribo-nucleoside involved in stress response. |
Pubmed ID | 11997336 |
Domain | CDD:412466 |
Functional Category | Ribosomal_protein |
Uniprot ID | Q8R7U8 |
ORF Length (Amino Acid) | 82 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2180522 | 2180770 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
2 | 409588 | 409812 | + | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
3 | 1969072 | 1969296 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
4 | 2299377 | 2299601 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
5 | 424531 | 424743 | + | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
6 | 348353 | 348568 | + | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
7 | 2262484 | 2262699 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
8 | 123107 | 123355 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
9 | 346705 | 346905 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
10 | 3683476 | 3683715 | - | NZ_CP028842.1 | Clostridium botulinum |
11 | 3964601 | 3964840 | - | NZ_CP011663.1 | Clostridium sporogenes |
12 | 2083659 | 2083901 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
13 | 4450889 | 4451131 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
14 | 2904123 | 2904335 | - | NZ_CP025197.1 | Acetivibrio saccincola |
15 | 261140 | 261379 | + | NZ_CP032416.1 | Clostridium fermenticellae |
16 | 209030 | 209278 | + | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
17 | 2603680 | 2603889 | - | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
18 | 208220 | 208459 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
19 | 2886691 | 2886930 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
20 | 1396944 | 1397186 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
21 | 2502574 | 2502810 | - | NZ_CP017237.1 | Moorella thermoacetica |
22 | 2755559 | 2755810 | - | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
23 | 4444336 | 4444578 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
24 | 296650 | 296871 | - | NZ_CP026363.1 | Brevibacillus agri |
25 | 3942418 | 3942657 | - | NZ_CP013019.1 | Clostridium pasteurianum |
26 | 3713522 | 3713737 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
27 | 4851776 | 4852027 | - | NZ_CP045293.1 | Paenibacillus guangzhouensis |
28 | 2968344 | 2968556 | - | NZ_CP045875.1 | Heliorestis convoluta |
29 | 432445 | 432696 | + | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
30 | 4231308 | 4231547 | - | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
31 | 2292019 | 2292225 | - | NC_015520.1 | Mahella australiensis 50-1 BON |
32 | 4381289 | 4381540 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
33 | 163022 | 163270 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
34 | 260115 | 260336 | + | NZ_LR134338.1 | Brevibacillus brevis |
35 | 2848400 | 2848606 | - | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
36 | 365258 | 365461 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
37 | 3443901 | 3444152 | + | NZ_CP008876.1 | Terribacillus goriensis |
38 | 5294713 | 5294955 | - | NZ_CP020953.1 | Clostridium drakei |
39 | 3631699 | 3631950 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
40 | 4629248 | 4629490 | + | NZ_CP009933.1 | Clostridium scatologenes |
41 | 464150 | 464362 | + | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
42 | 297173 | 297379 | + | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
43 | 771629 | 771838 | + | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
44 | 116031 | 116264 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
45 | 642826 | 643035 | + | NZ_CP014176.1 | Clostridium argentinense |
46 | 3715078 | 3715308 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
47 | 3541991 | 3542233 | - | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
48 | 4583234 | 4583446 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
49 | 381206 | 381457 | + | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
50 | 227143 | 227388 | + | NC_009253.1 | Desulfotomaculum reducens MI-1 |
51 | 1091625 | 1091864 | + | NZ_AP019004.1 | Phascolarctobacterium faecium |
52 | 59489 | 59728 | - | NZ_CP039710.1 | Thermoactinomyces vulgaris |
53 | 2078089 | 2078352 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
54 | 299177 | 299389 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00338.24 | 0.76 | 41 | 4746 | same-strand | Ribosomal protein S10p/S20e |
2 | PF00009.29 | 1.0 | 54 | 1328.0 | same-strand | Elongation factor Tu GTP binding domain |
3 | PF03143.19 | 0.98 | 53 | 3301 | same-strand | Elongation factor Tu C-terminal domain |
4 | PF03144.27 | 1.0 | 54 | 1328.0 | same-strand | Elongation factor Tu domain 2 |
5 | PF01926.25 | 0.94 | 51 | 3262.5 | same-strand | 50S ribosome-binding GTPase |
6 | PF03764.20 | 1.0 | 54 | 1133.0 | same-strand | Elongation factor G, domain IV |
7 | PF14492.8 | 1.0 | 54 | 1133.0 | same-strand | Elongation Factor G, domain III |
8 | PF00679.26 | 1.0 | 54 | 1133.0 | same-strand | Elongation factor G C-terminus |
9 | PF00177.23 | 1.0 | 54 | 611.0 | same-strand | Ribosomal protein S7p/S5e |
10 | PF00164.27 | 1.0 | 54 | 81.0 | same-strand | Ribosomal protein S12/S23 |
11 | PF04997.14 | 0.94 | 51 | 126 | same-strand | RNA polymerase Rpb1, domain 1 |
12 | PF04998.19 | 0.72 | 39 | 126 | same-strand | RNA polymerase Rpb1, domain 5 |
13 | PF04983.20 | 0.96 | 52 | 126.0 | same-strand | RNA polymerase Rpb1, domain 3 |
14 | PF00562.30 | 0.96 | 52 | 3713.0 | same-strand | RNA polymerase Rpb2, domain 6 |
15 | PF04565.18 | 0.96 | 52 | 3713.0 | same-strand | RNA polymerase Rpb2, domain 3 |
16 | PF10385.11 | 0.96 | 52 | 3713.0 | same-strand | RNA polymerase beta subunit external 1 domain |
17 | PF04563.17 | 0.96 | 52 | 3713.0 | same-strand | RNA polymerase beta subunit |
18 | PF04560.22 | 0.96 | 52 | 3713.0 | same-strand | RNA polymerase Rpb2, domain 7 |
19 | PF00542.21 | 0.87 | 47 | 7705 | same-strand | Ribosomal protein L7/L12 C-terminal domain |
20 | PF16320.7 | 0.87 | 47 | 7705 | same-strand | Ribosomal protein L7/L12 dimerisation domain |
21 | PF00466.22 | 0.78 | 42 | 8101.5 | same-strand | Ribosomal protein L10 |
22 | PF00687.23 | 0.67 | 36 | 8804.5 | same-strand | Ribosomal protein L1p/L10e family |