Result : Q8R678
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | AE009951.2 |
| Organism | Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355) |
| Left | 1414753 |
| Right | 1415043 |
| Strand | - |
| Nucleotide Sequence | ATGGCACTAACAAGGGAAGAAGTTCTTAAAATTGCAAAATTATCAAAGTTATCATTTGAAGATAAAGAAATAGAAAAATTTCAGGTTGAATTAAATGATATTCTAAAATATATTGATATGTTAAATGAAGTTGATACATCAAAAGTTGAACCCTTAGTTTACATAAATGAATCTGTCAATAATTTTAGAGAAAAAGAAGAAAAACCATCATTAGAAATAGAAAAAGTTCTATTTAATGCACCTGAAAGTGCTGAAAATGCAATAGTAGTTCCAAAGGTTATTGGAGAGTAG |
| Sequence | MALTREEVLKIAKLSKLSFEDKEIEKFQVELNDILKYIDMLNEVDTSKVEPLVYINESVNNFREKEEKPSLEIEKVLFNAPESAENAIVVPKVIGE |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | 11889109 |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | Q8R678 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1590654 | 1590944 | + | NZ_CP068114.1 | Fusobacterium canifelinum |
| 2 | 1482913 | 1483203 | + | NZ_LN831027.1 | Fusobacterium nucleatum subsp. polymorphum |
| 3 | 1621816 | 1622106 | - | NZ_CP013336.1 | Fusobacterium hwasookii ChDC F206 |
| 4 | 164651 | 164941 | + | NZ_CP024699.1 | Fusobacterium pseudoperiodonticum |
| 5 | 677760 | 678053 | + | NZ_CP028106.1 | Fusobacterium gonidiaformans ATCC 25563 |
| 6 | 755502 | 755795 | - | NZ_CP028107.1 | Fusobacterium necrophorum subsp. funduliforme |
| 7 | 223840 | 224130 | + | NZ_CP028103.1 | Fusobacterium varium ATCC 27725 |
| 8 | 2334389 | 2334679 | - | NZ_CP028105.1 | Fusobacterium ulcerans |
| 9 | 670352 | 670642 | + | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
| 10 | 2562984 | 2563274 | - | NZ_CP028102.1 | Fusobacterium mortiferum ATCC 9817 |
| 11 | 2041739 | 2042026 | - | NC_011059.1 | Prosthecochloris aestuarii DSM 271 |
| 12 | 197145 | 197411 | + | NZ_AP019822.1 | Pseudoleptotrichia goodfellowii |
| 13 | 1515575 | 1515859 | + | NC_000918.1 | Aquifex aeolicus VF5 |
| 14 | 1849767 | 1850066 | + | NZ_AP019827.1 | Leptotrichia shahii |
| 15 | 2052053 | 2052352 | - | NZ_AP019829.2 | Leptotrichia wadei |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP068114.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06723.15 | 0.67 | 10 | 2465.5 | same-strand | MreB/Mbl protein |
| 2 | PF14450.8 | 0.6 | 9 | 2867 | same-strand | Cell division protein FtsA |
| 3 | PF04079.18 | 0.73 | 11 | 713 | same-strand | Segregation and condensation complex subunit ScpB |
| 4 | PF00849.24 | 0.8 | 12 | 21.0 | same-strand | RNA pseudouridylate synthase |
| 5 | PF01479.27 | 0.8 | 12 | 25 | same-strand | S4 domain |
| 6 | PF01425.23 | 0.87 | 13 | 25 | same-strand | Amidase |
| 7 | PF02934.17 | 0.87 | 13 | 1505 | same-strand | GatB/GatE catalytic domain |
| 8 | PF02637.20 | 0.87 | 13 | 1505 | same-strand | GatB domain |
++ More..