Protein Information |
Information Type | Description |
---|---|
Protein name | Cell division protein FtsL |
NCBI Accession ID | AE008922.1 |
Organism | Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) |
Left | 861818 |
Right | 862081 |
Strand | + |
Nucleotide Sequence | ATGAGCCGCCTGCTGCTCATCGTGCTGCTCGCCTGCAGCATCGCCTCGGCGATCGGTGTGGTGTACATGCGCCACATGCATCGCAAGTTGTTCGTGCAGTTGTCCAAGCTCGAACACAGCCGCGATGAATTGAATATCGAATTCGGCCGGCTGCAGCTGGAGCAGGCCACGTGGGCGGAAAGCAATCGCGTGGATCAGGTCTCGCGTGAGCGCATCGGGATGAAGTTCCCGGAGACCAGCGACATCGTGGTGATCCGCCCATGA |
Sequence | MSRLLLIVLLACSIASAIGVVYMRHMHRKLFVQLSKLEHSRDELNIEFGRLQLEQATWAESNRVDQVSRERIGMKFPETSDIVVIRP |
Source of smORF | Swiss-Prot |
Function | Essential cell division protein. May link together the upstream cell division proteins, which are predominantly cytoplasmic, with the downstream cell division proteins, which are predominantly periplasmic. {ECO:0000255|HAMAP-Rule:MF_00910}. |
Pubmed ID | 12024217 |
Domain | CDD:416267 |
Functional Category | Others |
Uniprot ID | Q8PCK6 |
ORF Length (Amino Acid) | 87 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3977700 | 3977963 | - | NZ_CP058243.1 | Xanthomonas campestris pv. raphani |
2 | 713153 | 713416 | + | NZ_CP007810.1 | Xanthomonas oryzae pv. oryzicola |
3 | 3892141 | 3892404 | + | NZ_CP018725.1 | Xanthomonas vesicatoria ATCC 35937 |
4 | 3457466 | 3457729 | - | NZ_LT853882.1 | Xanthomonas fragariae |
5 | 711808 | 712071 | + | NZ_CP033326.1 | Xanthomonas cucurbitae |
6 | 981091 | 981354 | + | NZ_CP072268.1 | Xanthomonas euvesicatoria pv. alfalfae |
7 | 925971 | 926234 | + | NZ_CP048044.1 | Xanthomonas citri |
8 | 955792 | 956055 | + | NZ_CP028127.1 | Xanthomonas vasicola pv. vasculorum |
9 | 2615193 | 2615435 | - | NZ_CP016878.1 | Xanthomonas hortorum |
10 | 3050024 | 3050287 | + | NZ_CP043476.1 | Xanthomonas hyacinthi |
11 | 2751332 | 2751595 | - | NZ_CP053627.1 | Xylella taiwanensis |
12 | 3294169 | 3294432 | - | NZ_CP046570.1 | Xanthomonas albilineans |
13 | 2201322 | 2201585 | - | NC_004556.1 | Xylella fastidiosa Temecula1 |
14 | 3326871 | 3327134 | - | NZ_CP012900.1 | Stenotrophomonas acidaminiphila |
15 | 754871 | 755134 | + | NZ_CP037883.1 | Stenotrophomonas indicatrix |
16 | 3019838 | 3020071 | - | NZ_CP041242.1 | Lysobacter alkalisoli |
17 | 4580209 | 4580421 | - | NZ_CP011131.1 | Lysobacter gummosus |
18 | 4798825 | 4799085 | - | NZ_CP023465.1 | Lysobacter capsici |
19 | 1201015 | 1201278 | + | NZ_AP014940.1 | Lysobacter enzymogenes |
20 | 698485 | 698748 | + | NZ_LS483377.1 | Stenotrophomonas maltophilia |
21 | 1343211 | 1343435 | + | NZ_CP011129.1 | Lysobacter antibioticus |
22 | 2125578 | 2125811 | - | NZ_CP071517.1 | Lysobacter arenosi |
23 | 814040 | 814273 | - | NZ_CP060820.1 | Lysobacter solisilvae (ex Woo and Kim 2020) |
24 | 402875 | 403138 | + | NC_016147.2 | Pseudoxanthomonas spadix BD-a59 |
25 | 2121023 | 2121286 | + | NZ_CP042218.1 | Luteimonas granuli |
26 | 1147821 | 1148045 | + | NZ_CP023406.1 | Luteimonas chenhongjianii |
27 | 847640 | 847873 | + | NZ_CP046603.1 | Lysobacter soli |
28 | 3939567 | 3939830 | - | NZ_CP060731.1 | Pseudoxanthomonas mexicana |
29 | 2317745 | 2317981 | + | NZ_CP060711.1 | Thermomonas brevis |
30 | 1692848 | 1693060 | - | NZ_CP029556.1 | Lysobacter oculi |
31 | 656570 | 656797 | + | NZ_CP015249.1 | Dokdonella koreensis DS-123 |
32 | 870586 | 870813 | + | NZ_CP035704.1 | Pseudolysobacter antarcticus |
33 | 2494982 | 2495209 | - | NZ_AP018560.1 | Aerosticca soli |
34 | 683294 | 683518 | + | NZ_AP018725.1 | Sulfuriflexus mobilis |
35 | 3452965 | 3453189 | - | NC_020541.1 | Rhodanobacter denitrificans |
36 | 361384 | 361626 | + | NZ_CP027860.1 | Ahniella affigens |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01098.21 | 0.86 | 31 | 5885 | same-strand | Cell cycle protein |
2 | PF00953.23 | 1.0 | 36 | 4832.0 | same-strand | Glycosyl transferase family 4 |
3 | PF10555.11 | 0.89 | 32 | 4832.0 | same-strand | Phospho-N-acetylmuramoyl-pentapeptide-transferase signature 1 |
4 | PF08245.14 | 1.0 | 36 | 3256 | same-strand | Mur ligase middle domain |
5 | PF02875.23 | 1.0 | 36 | 1976 | same-strand | Mur ligase family, glutamate ligase domain |
6 | PF01225.27 | 1.0 | 36 | 1976 | same-strand | Mur ligase family, catalytic domain |
7 | PF00905.24 | 1.0 | 36 | -3.0 | same-strand | Penicillin binding protein transpeptidase domain |
8 | PF03717.17 | 1.0 | 36 | -3.0 | same-strand | Penicillin-binding Protein dimerisation domain |
9 | PF01795.21 | 1.0 | 36 | -3.0 | same-strand | MraW methylase family |
10 | PF02381.20 | 0.94 | 34 | 1019.5 | same-strand | MraZ protein, putative antitoxin-like |