| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative fluoride ion transporter CrcB 1 |
| NCBI Accession ID | BA000036.3 |
| Organism | Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) |
| Left | 2690151 |
| Right | 2690441 |
| Strand | + |
| Nucleotide Sequence | ATGCAGAAACTCATCCAAGGGCTAGGTGTCGGCGCGGGTGCCGCGTTGGGGGTGTGCGTGCGCCTTGCGCTGACGTTGTGGCTCGGCGATTCCGCCTGGCCGATCCTGACCATCAACGTGCTGGGAGCGTTTCTGATGGGCTGGTTGCGCCCCAACGCGTTCTGGGGCACAGGTTTCCTGGGCGGCTTCACCACCTTTTCGGCCATGATGCTTAACGACGTCTCCTTCTATTTCTTCACCGCTGTGGGCTGCATTCTCGCCTGGTTAGCTGGGGATCGGTTGGCGCGATGA |
| Sequence | MQKLIQGLGVGAGAALGVCVRLALTLWLGDSAWPILTINVLGAFLMGWLRPNAFWGTGFLGGFTTFSAMMLNDVSFYFFTAVGCILAWLAGDRLAR |
| Source of smORF | Swiss-Prot |
| Function | Important for reducing fluoride concentration in the cell, thus reducing its toxicity. {ECO:0000255|HAMAP-Rule:MF_00454}. |
| Pubmed ID | 12743753 12948626 |
| Domain | CDD:415588 |
| Functional Category | Others |
| Uniprot ID | Q8NMM9 |
| ORF Length (Amino Acid) | 96 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2858993 | 2859283 | + | NZ_AP017369.1 | Corynebacterium suranareeae |
| 2 | 2448558 | 2448848 | + | NZ_CP015622.1 | Corynebacterium crudilactis |
| 3 | 2382134 | 2382424 | + | NZ_CP009220.1 | Corynebacterium deserti GIMN1.010 |
| 4 | 2302239 | 2302535 | + | NC_020506.1 | Corynebacterium callunae DSM 20147 |
| 5 | 2587858 | 2588172 | + | NC_004369.1 | Corynebacterium efficiens YS-314 |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00107.28 | 1.0 | 5 | 3368 | opposite-strand | Zinc-binding dehydrogenase |
| 2 | PF02878.18 | 1.0 | 5 | 101 | opposite-strand | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I |
| 3 | PF02880.18 | 1.0 | 5 | 101 | opposite-strand | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III |
| 4 | PF02879.18 | 1.0 | 5 | 101 | opposite-strand | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II |
| 5 | PF00408.22 | 1.0 | 5 | 101 | opposite-strand | Phosphoglucomutase/phosphomannomutase, C-terminal domain |
| 6 | PF02537.17 | 1.0 | 5 | -3 | same-strand | CrcB-like protein, Camphor Resistance (CrcB) |
| 7 | PF07286.14 | 0.6 | 3 | 335 | same-strand | Protein of unknown function (DUF1445) |
| 8 | PF07853.13 | 1.0 | 5 | 1126 | opposite-strand | Protein of unknown function (DUF1648) |
| 9 | PF00375.20 | 0.6 | 3 | 1933 | opposite-strand | Sodium:dicarboxylate symporter family |
| 10 | PF02687.23 | 0.8 | 4 | 3142.5 | opposite-strand | FtsX-like permease family |
| 11 | PF12704.9 | 0.8 | 4 | 3142.5 | opposite-strand | MacB-like periplasmic core domain |
| 12 | PF12900.9 | 0.6 | 3 | 4401 | opposite-strand | Pyridoxamine 5'-phosphate oxidase |