Result : Q8L3B2

Protein Information

• Protein name: NADH-dependent phenylglyoxylate dehydrogenase subunit delta (EC 1.2.1.58) (Phenylglyoxylate:NAD oxidoreductase) (Phenylglyoxylate:acceptor oxidoreductase)
• NCBI Accession ID: AJ428571.1
• Organism: Aromatoleum evansii (Azoarcus evansii)
• Left: 6873
• Right: 7154
• Strand: +
• Nucleotide Sequence: ATGAGCCGGCACCAAAGCTACCCGCTGTTCAACCTCGAACAGGCCGGCGTCCCGGACGACCTCTGTCCGGTCGCGACGGTCGTCAGCCCCATGCTGCCCGGCGACTGGCGCAGCATGCGGCCGGTGGTCGATCGCGACAAATGCGTGAAATGCGCGGTGTGCTGGCTGTACTGCCCTGTGCAGTGCGTCGAGGAGCACGCCGCCTGGTTCGACTTCAACCTCAAGACCTGCAAGGGCTGCGGCATCTGTGCCAACGAGTGCCCGCAGCGGCGATCACGATGA
• Sequence: MSRHQSYPLFNLEQAGVPDDLCPVATVVSPMLPGDWRSMRPVVDRDKCVKCAVCWLYCPVQCVEEHAAWFDFNLKTCKGCGICANECPQRRSR
• Source of smORF: Swiss-Prot
• Function: Involved in the anaerobic metabolism of phenylalanine and phenylacetate. Catalyzes the oxidative decarboxylation of phenylglyoxylate to benzoyl-CoA and CO(2). It can also react slowly with 2-oxo-3-methylbutanoate and use different electron acceptors such as benzyl viologen, methyl viologen, FAD or FMN, but NAD seems to be the physiological electron acceptor. Also catalyzes an isotope exchange between CO(2) and the carboxyl group which proves partial or complete reversibility of the oxidative decarboxylation reaction. {ECO:0000269|Pubmed:9490067}.
• Pubmed ID: 9490067
• Functional Category: Metal-binding
• Uniprot ID: Q8L3B2
• ORF Length (Amino Acid): 93

Conservation Analysis

No. of Species: 7

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	4230590	4230889	+	NZ_CP059560.1	Aromatoleum petrolei
2	33882	34157	-	NZ_CP059560.1	Aromatoleum petrolei
3	3207577	3207876	+	NC_006513.1	Aromatoleum aromaticum EbN1
4	2327909	2328208	-	NZ_CP059467.1	Aromatoleum bremense
5	394166	394465	-	NZ_CP059467.1	Aromatoleum bremense
6	1397088	1397378	-	NZ_CP059467.1	Aromatoleum bremense
7	1650784	1651083	+	NZ_AP012547.1	Sulfuritalea hydrogenivorans sk43H
8	1366004	1366306	-	NZ_CP028339.1	Thauera aromatica K172
9	2308728	2309030	-	NZ_CP018839.1	Thauera chlorobenzoica
10	4916696	4916938	+	NC_018645.1	Desulfobacula toluolica Tol2

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_CP059560.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00384.24	0.86	6	2208.5	same-strand	Molybdopterin oxidoreductase
2	PF12838.9	1.0	7	2565.0	same-strand	4Fe-4S dicluster domain
3	PF13187.8	1.0	7	2565.0	same-strand	4Fe-4S dicluster domain
4	PF13237.8	1.0	7	2487	same-strand	4Fe-4S dicluster domain
5	PF12837.9	1.0	7	1579	same-strand	4Fe-4S binding domain
6	PF00037.29	0.86	6	1579.0	same-strand	4Fe-4S binding domain
7	PF12797.9	1.0	7	2087.0	same-strand	4Fe-4S binding domain
8	PF01558.20	1.0	7	-3.0	same-strand	Pyruvate ferredoxin/flavodoxin oxidoreductase
9	PF01855.21	1.0	7	3.0	same-strand	Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg
10	PF17147.6	1.0	7	3.0	same-strand	Pyruvate:ferredoxin oxidoreductase core domain II
11	PF07992.16	1.0	7	1288.0	same-strand	Pyridine nucleotide-disulphide oxidoreductase
12	PF00070.29	1.0	7	1288.0	same-strand	Pyridine nucleotide-disulphide oxidoreductase
13	PF02775.23	1.0	7	2568.0	same-strand	Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
14	PF13247.8	1.0	7	2568.0	same-strand	4Fe-4S dicluster domain
15	PF14535.8	0.86	6	3940.5	same-strand	AMP-binding enzyme C-terminal domain
16	PF13607.8	0.71	5	5322.5	same-strand	Succinyl-CoA ligase like flavodoxin domain
17	PF13380.8	0.71	5	5322.5	same-strand	CoA binding domain