Protein Information |
Information Type | Description |
---|---|
Protein name | NADH-dependent phenylglyoxylate dehydrogenase subunit delta (EC 1.2.1.58) (Phenylglyoxylate:NAD oxidoreductase) (Phenylglyoxylate:acceptor oxidoreductase) |
NCBI Accession ID | AJ428571.1 |
Organism | Aromatoleum evansii (Azoarcus evansii) |
Left | 6873 |
Right | 7154 |
Strand | + |
Nucleotide Sequence | ATGAGCCGGCACCAAAGCTACCCGCTGTTCAACCTCGAACAGGCCGGCGTCCCGGACGACCTCTGTCCGGTCGCGACGGTCGTCAGCCCCATGCTGCCCGGCGACTGGCGCAGCATGCGGCCGGTGGTCGATCGCGACAAATGCGTGAAATGCGCGGTGTGCTGGCTGTACTGCCCTGTGCAGTGCGTCGAGGAGCACGCCGCCTGGTTCGACTTCAACCTCAAGACCTGCAAGGGCTGCGGCATCTGTGCCAACGAGTGCCCGCAGCGGCGATCACGATGA |
Sequence | MSRHQSYPLFNLEQAGVPDDLCPVATVVSPMLPGDWRSMRPVVDRDKCVKCAVCWLYCPVQCVEEHAAWFDFNLKTCKGCGICANECPQRRSR |
Source of smORF | Swiss-Prot |
Function | Involved in the anaerobic metabolism of phenylalanine and phenylacetate. Catalyzes the oxidative decarboxylation of phenylglyoxylate to benzoyl-CoA and CO(2). It can also react slowly with 2-oxo-3-methylbutanoate and use different electron acceptors such as benzyl viologen, methyl viologen, FAD or FMN, but NAD seems to be the physiological electron acceptor. Also catalyzes an isotope exchange between CO(2) and the carboxyl group which proves partial or complete reversibility of the oxidative decarboxylation reaction. {ECO:0000269|Pubmed:9490067}. |
Pubmed ID | 9490067 |
Domain | |
Functional Category | Metal-binding |
Uniprot ID | Q8L3B2 |
ORF Length (Amino Acid) | 93 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4230590 | 4230889 | + | NZ_CP059560.1 | Aromatoleum petrolei |
2 | 33882 | 34157 | - | NZ_CP059560.1 | Aromatoleum petrolei |
3 | 3207577 | 3207876 | + | NC_006513.1 | Aromatoleum aromaticum EbN1 |
4 | 2327909 | 2328208 | - | NZ_CP059467.1 | Aromatoleum bremense |
5 | 394166 | 394465 | - | NZ_CP059467.1 | Aromatoleum bremense |
6 | 1397088 | 1397378 | - | NZ_CP059467.1 | Aromatoleum bremense |
7 | 1650784 | 1651083 | + | NZ_AP012547.1 | Sulfuritalea hydrogenivorans sk43H |
8 | 1366004 | 1366306 | - | NZ_CP028339.1 | Thauera aromatica K172 |
9 | 2308728 | 2309030 | - | NZ_CP018839.1 | Thauera chlorobenzoica |
10 | 4916696 | 4916938 | + | NC_018645.1 | Desulfobacula toluolica Tol2 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00384.24 | 0.86 | 6 | 2208.5 | same-strand | Molybdopterin oxidoreductase |
2 | PF12838.9 | 1.0 | 7 | 2565.0 | same-strand | 4Fe-4S dicluster domain |
3 | PF13187.8 | 1.0 | 7 | 2565.0 | same-strand | 4Fe-4S dicluster domain |
4 | PF13237.8 | 1.0 | 7 | 2487 | same-strand | 4Fe-4S dicluster domain |
5 | PF12837.9 | 1.0 | 7 | 1579 | same-strand | 4Fe-4S binding domain |
6 | PF00037.29 | 0.86 | 6 | 1579.0 | same-strand | 4Fe-4S binding domain |
7 | PF12797.9 | 1.0 | 7 | 2087.0 | same-strand | 4Fe-4S binding domain |
8 | PF01558.20 | 1.0 | 7 | -3.0 | same-strand | Pyruvate ferredoxin/flavodoxin oxidoreductase |
9 | PF01855.21 | 1.0 | 7 | 3.0 | same-strand | Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg |
10 | PF17147.6 | 1.0 | 7 | 3.0 | same-strand | Pyruvate:ferredoxin oxidoreductase core domain II |
11 | PF07992.16 | 1.0 | 7 | 1288.0 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
12 | PF00070.29 | 1.0 | 7 | 1288.0 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
13 | PF02775.23 | 1.0 | 7 | 2568.0 | same-strand | Thiamine pyrophosphate enzyme, C-terminal TPP binding domain |
14 | PF13247.8 | 1.0 | 7 | 2568.0 | same-strand | 4Fe-4S dicluster domain |
15 | PF14535.8 | 0.86 | 6 | 3940.5 | same-strand | AMP-binding enzyme C-terminal domain |
16 | PF13607.8 | 0.71 | 5 | 5322.5 | same-strand | Succinyl-CoA ligase like flavodoxin domain |
17 | PF13380.8 | 0.71 | 5 | 5322.5 | same-strand | CoA binding domain |