Protein Information |
Information Type | Description |
---|---|
Protein name | 30S ribosomal protein S16 |
NCBI Accession ID | |
Organism | Tremblaya princeps |
Left | |
Right | |
Strand | |
Nucleotide Sequence | |
Sequence | MLAIRLRRCGARGRPAYQVVVADSRRKRNGVFLCRVGYYNPRLKSAHIDTVMLRLWTERGAAPTRTVARLLHRHAAGCTAAARNSGSVCPHWQ |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00368. Profile Description: Ribosomal protein S16. This model describes ribosomal S16 of bacteria and organelles. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
Pubmed ID | 12088995 |
Domain | CDD:412339 |
Functional Category | Ribosomal_protein |
Uniprot ID | Q8KTS4 |
ORF Length (Amino Acid) | 93 |