| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S16 |
| NCBI Accession ID | |
| Organism | Tremblaya princeps |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MLAIRLRRCGARGRPAYQVVVADSRRKRNGVFLCRVGYYNPRLKSAHIDTVMLRLWTERGAAPTRTVARLLHRHAAGCTAAARNSGSVCPHWQ |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00368. Profile Description: Ribosomal protein S16. This model describes ribosomal S16 of bacteria and organelles. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 12088995 |
| Domain | CDD:412339 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q8KTS4 |
| ORF Length (Amino Acid) | 93 |