Result : Q8KCZ7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Ferredoxin-2 (Ferredoxin II) (FdII) |
| NCBI Accession ID | AE006470.1 |
| Organism | Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) (Chlorobium tepidum) |
| Left | 1184078 |
| Right | 1184266 |
| Strand | + |
| Nucleotide Sequence | ATGGCACACCGTATTACCGATGAATGCACCTACTGTGCAGCCTGCGAGCCGGAATGTCCGGTCAGCGCGATCTCCGCTGGCGACTCTATTTACGTGATCGACGAGAATGTATGCGTGGATTGTATCGGCTATCACGACGAGCCTGCCTGTGTGGCCGTCTGCCCGGTGGACTGCATTATCAAGGTATAG |
| Sequence | MAHRITDECTYCAACEPECPVSAISAGDSIYVIDENVCVDCIGYHDEPACVAVCPVDCIIKV |
| Source of smORF | Swiss-Prot |
| Function | Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions. |
| Pubmed ID | 12093901 |
| Domain | |
| Functional Category | Metal-binding |
| Uniprot ID | Q8KCZ7 |
| ORF Length (Amino Acid) | 62 |
++ More..
| Conservation Analysis |
No. of Species: 198
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1184078 | 1184266 | + | NC_002932.3 | Chlorobaculum tepidum TLS |
| 2 | 1649300 | 1649488 | + | NC_002932.3 | Chlorobaculum tepidum TLS |
| 3 | 1184476 | 1184664 | + | NC_002932.3 | Chlorobaculum tepidum TLS |
| 4 | 1380439 | 1380627 | + | NC_011027.1 | Chlorobaculum parvum NCIB 8327 |
| 5 | 1380815 | 1381003 | + | NC_011027.1 | Chlorobaculum parvum NCIB 8327 |
| 6 | 1068020 | 1068208 | - | NZ_CP017305.1 | Chlorobaculum limnaeum |
| 7 | 1961638 | 1961826 | + | NZ_CP017305.1 | Chlorobaculum limnaeum |
| 8 | 1067633 | 1067821 | - | NZ_CP017305.1 | Chlorobaculum limnaeum |
| 9 | 1373544 | 1373732 | + | NC_007512.1 | Pelodictyon luteolum DSM 273 |
| 10 | 116017 | 116205 | + | NC_007512.1 | Pelodictyon luteolum DSM 273 |
| 11 | 1373912 | 1374100 | + | NC_007512.1 | Pelodictyon luteolum DSM 273 |
| 12 | 1259905 | 1260093 | - | NC_010803.1 | Chlorobium limicola DSM 245 |
| 13 | 896424 | 896612 | - | NC_010803.1 | Chlorobium limicola DSM 245 |
| 14 | 1257896 | 1258084 | - | NC_010803.1 | Chlorobium limicola DSM 245 |
| 15 | 1509003 | 1509191 | + | NC_011059.1 | Prosthecochloris aestuarii DSM 271 |
| 16 | 1509414 | 1509599 | + | NC_011059.1 | Prosthecochloris aestuarii DSM 271 |
| 17 | 618775 | 618960 | - | NC_011059.1 | Prosthecochloris aestuarii DSM 271 |
| 18 | 1611793 | 1611981 | + | NC_008639.1 | Chlorobium phaeobacteroides DSM 266 |
| 19 | 1612909 | 1613097 | + | NC_008639.1 | Chlorobium phaeobacteroides DSM 266 |
| 20 | 1200559 | 1200750 | - | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
| 21 | 1459514 | 1459702 | + | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
| 22 | 1200237 | 1200425 | - | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
| 23 | 1307567 | 1307752 | - | NC_011891.1 | Anaeromyxobacter dehalogenans 2CP-1 |
| 24 | 3630729 | 3630947 | - | NZ_CP011835.1 | Azotobacter chroococcum |
| 25 | 996359 | 996577 | + | NC_012560.1 | Azotobacter vinelandii DJ |
| 26 | 3145804 | 3145992 | - | NC_017584.1 | Rhodospirillum rubrum F11 |
| 27 | 1184452 | 1184637 | + | NC_017584.1 | Rhodospirillum rubrum F11 |
| 28 | 4221234 | 4221428 | + | NZ_CP059560.1 | Aromatoleum petrolei |
| 29 | 545132 | 545332 | - | NZ_CP059560.1 | Aromatoleum petrolei |
| 30 | 1730135 | 1730305 | + | NZ_CP022423.1 | Vitreoscilla filiformis |
| 31 | 3062851 | 3063042 | + | NC_017059.1 | Pararhodospirillum photometricum DSM 122 |
| 32 | 3200125 | 3200322 | + | NC_006513.1 | Aromatoleum aromaticum EbN1 |
| 33 | 401718 | 401915 | - | NZ_CP059467.1 | Aromatoleum bremense |
| 34 | 1652723 | 1652941 | + | NC_015942.1 | Acidithiobacillus ferrivorans SS3 |
| 35 | 2553577 | 2553771 | - | NZ_CP029347.1 | Saliniradius amylolyticus |
| 36 | 2275893 | 2276111 | + | NZ_AP018795.1 | Acidithiobacillus ferridurans |
| 37 | 1327506 | 1327724 | + | NC_011761.1 | Acidithiobacillus ferrooxidans ATCC 23270 |
| 38 | 211303 | 211527 | + | NC_002977.6 | Methylococcus capsulatus str. Bath |
| 39 | 1711522 | 1711710 | - | NC_007626.1 | Magnetospirillum magneticum AMB-1 |
| 40 | 3256260 | 3256478 | - | NZ_CP011930.1 | Herbaspirillum seropedicae |
| 41 | 2783793 | 2784011 | - | NZ_CP013737.1 | Herbaspirillum rubrisubalbicans M1 |
| 42 | 1663266 | 1663460 | + | NC_008781.1 | Polaromonas naphthalenivorans CJ2 |
| 43 | 537240 | 537434 | + | NZ_CP019240.1 | Rhodoferax antarcticus |
| 44 | 450821 | 451045 | + | NC_010794.1 | Methylacidiphilum infernorum V4 |
| 45 | 1492933 | 1493127 | + | NC_010524.1 | Leptothrix cholodnii SP-6 |
| 46 | 1821489 | 1821680 | + | NZ_CP029829.1 | Azospirillum ramasamyi |
| 47 | 1667104 | 1667295 | - | NZ_CP012401.1 | Azospirillum thiophilum |
| 48 | 5074281 | 5074475 | - | NZ_CP058907.1 | Rhodopseudomonas palustris |
| 49 | 4663854 | 4664024 | - | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 50 | 2637426 | 2637620 | - | NZ_CP017562.1 | Paraburkholderia sprentiae WSM5005 |
| 51 | 2588203 | 2588397 | + | NC_020453.1 | Bradyrhizobium oligotrophicum S58 |
| 52 | 193887 | 194084 | - | NC_006512.1 | Idiomarina loihiensis L2TR |
| 53 | 2261532 | 2261702 | - | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 54 | 3113330 | 3113500 | - | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 55 | 924930 | 925121 | - | NZ_CP054619.1 | Azospirillum oryzae |
| 56 | 3275272 | 3275442 | - | NZ_CP025197.1 | Acetivibrio saccincola |
| 57 | 1415329 | 1415517 | - | NZ_CP019948.1 | Methylocystis bryophila |
| 58 | 12530 | 12724 | - | NZ_CP022991.1 | Paraburkholderia aromaticivorans |
| 59 | 1774643 | 1774837 | - | NC_007952.1 | Paraburkholderia xenovorans LB400 |
| 60 | 654527 | 654736 | + | NZ_CP022132.1 | Francisella halioticida |
| 61 | 185841 | 186011 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 62 | 3942782 | 3943006 | + | NC_009937.1 | Azorhizobium caulinodans ORS 571 |
| 63 | 4082801 | 4082974 | + | NC_011894.1 | Methylobacterium nodulans ORS 2060 |
| 64 | 2081012 | 2081182 | - | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 65 | 17728 | 17898 | - | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 66 | 3718440 | 3718631 | - | NZ_CP030265.1 | Skermanella pratensis |
| 67 | 5702479 | 5702691 | - | NZ_CP016428.1 | Bradyrhizobium icense |
| 68 | 5751298 | 5751492 | - | NZ_CP016428.1 | Bradyrhizobium icense |
| 69 | 219438 | 219608 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 70 | 2220557 | 2220727 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 71 | 1821583 | 1821771 | - | NZ_CP044331.1 | Methylocystis parvus |
| 72 | 1731950 | 1732117 | + | NZ_CP032364.1 | Lachnoanaerobaculum umeaense |
| 73 | 875387 | 875557 | + | NC_014836.1 | Desulfurispirillum indicum S5 |
| 74 | 1731555 | 1731728 | - | NC_011899.1 | Halothermothrix orenii H 168 |
| 75 | 1109333 | 1109503 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 76 | 255908 | 256078 | + | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 77 | 2219719 | 2219889 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 78 | 2602475 | 2602648 | - | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 79 | 2662164 | 2662334 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 80 | 5544968 | 5545138 | + | NZ_CP020953.1 | Clostridium drakei |
| 81 | 4355759 | 4355929 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 82 | 2414875 | 2415045 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 83 | 737435 | 737605 | - | NZ_CP014150.1 | Paeniclostridium sordellii |
| 84 | 3389355 | 3389525 | + | NZ_CP014150.1 | Paeniclostridium sordellii |
| 85 | 2119389 | 2119583 | + | NZ_CP022221.1 | Bradyrhizobium zhanjiangense |
| 86 | 851316 | 851486 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 87 | 367934 | 368104 | - | NZ_CP009687.1 | Clostridium aceticum |
| 88 | 3825588 | 3825758 | + | NZ_CP019870.1 | Clostridioides difficile |
| 89 | 1159586 | 1159756 | - | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 90 | 734667 | 734837 | - | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 91 | 114879 | 115049 | + | NC_018664.1 | Gottschalkia acidurici 9a |
| 92 | 1150128 | 1150298 | - | NZ_CP014176.1 | Clostridium argentinense |
| 93 | 919491 | 919658 | + | NC_015436.1 | Sphaerochaeta coccoides DSM 17374 |
| 94 | 3032001 | 3032171 | + | NZ_CP048649.1 | Aminipila butyrica |
| 95 | 287361 | 287528 | + | NZ_CP035130.1 | Gudongella oleilytica |
| 96 | 354289 | 354456 | - | NZ_CP035108.1 | Geovibrio thiophilus |
| 97 | 7112829 | 7113038 | - | NZ_LS398110.1 | Bradyrhizobium vignae |
| 98 | 7150226 | 7150420 | - | NZ_LS398110.1 | Bradyrhizobium vignae |
| 99 | 69953 | 70126 | + | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 100 | 3260190 | 3260360 | - | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 101 | 1204142 | 1204309 | - | NZ_LR134523.1 | Peptoniphilus ivorii |
| 102 | 1143946 | 1144137 | - | NZ_CP029353.1 | Azospirillum thermophilum |
| 103 | 646191 | 646361 | + | NC_014758.1 | Calditerrivibrio nitroreducens DSM 19672 |
| 104 | 950860 | 951030 | + | NC_014654.1 | Halanaerobium hydrogeniformans |
| 105 | 2188791 | 2188961 | - | NZ_LR130778.1 | Petrocella atlantisensis |
| 106 | 4694776 | 4694946 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 107 | 109050 | 109220 | + | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 108 | 310151 | 310321 | - | NZ_CP036523.1 | Peptacetobacter hiranonis |
| 109 | 1266351 | 1266524 | - | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 110 | 1862582 | 1862755 | - | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 111 | 2176669 | 2176839 | + | NZ_CP009228.1 | Treponema putidum |
| 112 | 1047649 | 1047843 | - | NZ_CP029425.1 | Bradyrhizobium ottawaense |
| 113 | 1838588 | 1838782 | + | NZ_CP032617.1 | Bradyrhizobium diazoefficiens |
| 114 | 1727378 | 1727572 | + | NZ_CP058354.1 | Bradyrhizobium japonicum |
| 115 | 2534337 | 2534504 | + | NC_013943.1 | Denitrovibrio acetiphilus DSM 12809 |
| 116 | 2318437 | 2318607 | - | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 117 | 126335 | 126505 | + | NZ_CP013019.1 | Clostridium pasteurianum |
| 118 | 2023193 | 2023363 | + | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 119 | 2245745 | 2245915 | - | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 120 | 405761 | 405931 | - | NZ_CP020559.1 | Clostridium formicaceticum |
| 121 | 1864195 | 1864362 | - | NC_010814.1 | Geobacter lovleyi SZ |
| 122 | 1531446 | 1531616 | + | NC_014833.1 | Ruminococcus albus 7 = DSM 20455 |
| 123 | 335940 | 336110 | - | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 124 | 219594 | 219761 | + | NZ_LT635480.1 | Ndongobacter massiliensis |
| 125 | 656967 | 657137 | - | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 126 | 702131 | 702301 | - | NZ_CP030280.1 | Blautia argi |
| 127 | 1694149 | 1694343 | + | NZ_CP030050.1 | Bradyrhizobium arachidis |
| 128 | 850392 | 850565 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 129 | 3472871 | 3473041 | - | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 130 | 4330556 | 4330726 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 131 | 1790048 | 1790218 | + | NC_002967.9 | Treponema denticola ATCC 35405 |
| 132 | 91656 | 91826 | + | NZ_CP028842.1 | Clostridium botulinum |
| 133 | 86476 | 86646 | + | NZ_CP011663.1 | Clostridium sporogenes |
| 134 | 2332868 | 2333041 | - | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 135 | 578972 | 579145 | + | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 136 | 512788 | 512982 | + | NC_010627.1 | Paraburkholderia phymatum STM815 |
| 137 | 547029 | 547223 | + | NC_010627.1 | Paraburkholderia phymatum STM815 |
| 138 | 545068 | 545241 | + | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 139 | 85545 | 85715 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 140 | 389674 | 389847 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 141 | 3428371 | 3428541 | + | NZ_LR699011.1 | Roseburia hominis |
| 142 | 1350727 | 1350897 | + | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 143 | 71048 | 71218 | + | NZ_LT906477.1 | Clostridium cochlearium |
| 144 | 4250137 | 4250307 | + | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 145 | 650381 | 650551 | + | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 146 | 409836 | 410006 | + | NC_015520.1 | Mahella australiensis 50-1 BON |
| 147 | 5032835 | 5033005 | - | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 148 | 390622 | 390789 | + | NC_018011.1 | Alistipes finegoldii DSM 17242 |
| 149 | 1027470 | 1027688 | + | NC_017161.1 | Hydrogenobacter thermophilus TK-6 |
| 150 | 426424 | 426597 | + | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 151 | 1186633 | 1186800 | - | NC_015152.1 | Sphaerochaeta globosa str. Buddy |
| 152 | 1445124 | 1445294 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 153 | 209358 | 209528 | + | NZ_CP016786.1 | Clostridium isatidis |
| 154 | 3218272 | 3218442 | - | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 155 | 4026722 | 4026892 | - | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 156 | 1053610 | 1053780 | + | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 157 | 2228076 | 2228249 | - | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 158 | 948022 | 948192 | + | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 159 | 930729 | 930899 | + | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 160 | 1632904 | 1633080 | + | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 161 | 1365837 | 1366007 | - | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 162 | 2449617 | 2449787 | - | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 163 | 357525 | 357695 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 164 | 6059250 | 6059420 | + | NZ_CP022464.2 | Enterocloster bolteae |
| 165 | 1244799 | 1244969 | + | NZ_LT990039.1 | Massilistercora timonensis |
| 166 | 956581 | 956748 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 167 | 766451 | 766621 | - | NZ_CP045875.1 | Heliorestis convoluta |
| 168 | 240464 | 240634 | + | NZ_CP014204.2 | Clostridium baratii |
| 169 | 4016769 | 4016936 | - | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 170 | 2302298 | 2302471 | - | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 171 | 831975 | 832148 | + | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 172 | 1558313 | 1558480 | - | NZ_CP013118.1 | Salinivirga cyanobacteriivorans |
| 173 | 5159476 | 5159643 | + | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 174 | 2601353 | 2601523 | - | NC_023035.1 | Salinispira pacifica |
| 175 | 1431470 | 1431637 | - | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 176 | 3077854 | 3078024 | - | NZ_AP018042.1 | Labilibaculum antarcticum |
| 177 | 3414417 | 3414587 | + | NZ_AP018042.1 | Labilibaculum antarcticum |
| 178 | 961169 | 961339 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 179 | 25848 | 26015 | + | NZ_AP019735.1 | Alistipes communis |
| 180 | 1116214 | 1116381 | + | NZ_LR134506.1 | Porphyromonas cangingivalis |
| 181 | 3018096 | 3018266 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 182 | 196187 | 196357 | + | NZ_CP017253.2 | Clostridium taeniosporum |
| 183 | 182282 | 182452 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 184 | 2872675 | 2872845 | - | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 185 | 2511155 | 2511325 | - | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 186 | 1748044 | 1748220 | - | NZ_CP067016.1 | Anaerococcus obesiensis |
| 187 | 1133166 | 1133342 | - | NZ_CP066014.1 | Anaerococcus vaginalis |
| 188 | 1903678 | 1903845 | - | NZ_LR027382.1 | Alistipes megaguti |
| 189 | 574117 | 574287 | + | NZ_LR134524.1 | Peptoniphilus harei |
| 190 | 839425 | 839592 | + | NC_016633.1 | Sphaerochaeta pleomorpha str. Grapes |
| 191 | 4281525 | 4281695 | - | NC_014624.2 | Eubacterium callanderi |
| 192 | 1017523 | 1017693 | - | NZ_CP071376.1 | Clostridium gasigenes |
| 193 | 652510 | 652680 | - | NZ_CP019962.1 | Eubacterium limosum |
| 194 | 2483219 | 2483401 | + | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 195 | 3575915 | 3576085 | - | NZ_CP030775.1 | Clostridium butyricum |
| 196 | 154513 | 154683 | + | NZ_CP043998.1 | Clostridium diolis |
| 197 | 159371 | 159541 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 198 | 3101823 | 3101996 | - | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 199 | 3935913 | 3936083 | - | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 200 | 696066 | 696242 | - | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 201 | 163548 | 163718 | + | NZ_HG917868.1 | Clostridium bornimense |
| 202 | 206681 | 206851 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 203 | 1969572 | 1969742 | + | NZ_CP023671.1 | Clostridium septicum |
| 204 | 2742850 | 2743020 | - | NZ_CP029487.1 | Eubacterium maltosivorans |
| 205 | 1776842 | 1777012 | + | NZ_CP070062.1 | Coprococcus comes |
| 206 | 1269834 | 1270025 | + | NZ_AP018907.1 | Blastochloris tepida |
| 207 | 1743029 | 1743199 | - | NZ_CP069450.1 | Butyricimonas virosa |
| 208 | 3386291 | 3386461 | - | NZ_CP040924.1 | Clostridium thermarum |
| 209 | 3451121 | 3451291 | + | NZ_CP007451.1 | Draconibacterium orientale |
| 210 | 937313 | 937483 | + | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 211 | 2936684 | 2936851 | - | NZ_CP041345.1 | Tenuifilum thalassicum |
| 212 | 1167543 | 1167713 | + | NC_010644.1 | Elusimicrobium minutum Pei191 |
| 213 | 570234 | 570413 | - | NC_014633.1 | Ilyobacter polytropus DSM 2926 |
| 214 | 960049 | 960216 | - | NC_022549.1 | Acholeplasma brassicae |
| 215 | 86013 | 86183 | - | NZ_LT632322.1 | Murdochiella vaginalis |
| 216 | 352400 | 352573 | + | NZ_CP009498.1 | Endomicrobium proavitum |
| 217 | 11311 | 11490 | + | NC_014634.1 | Ilyobacter polytropus DSM 2926 |
| 218 | 1920575 | 1920742 | + | NZ_LT605205.1 | Proteiniphilum saccharofermentans |
| 219 | 2174028 | 2174195 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 220 | 359098 | 359265 | + | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
| 221 | 359307 | 359474 | + | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
| 222 | 3556773 | 3556946 | - | NZ_CP019646.1 | Limihaloglobus sulfuriphilus |
| 223 | 1123431 | 1123616 | - | NC_009634.1 | Methanococcus vannielii SB |
| 224 | 729620 | 729796 | - | NC_014253.1 | Methanohalobium evestigatum Z-7303 |
| 225 | 547915 | 548091 | + | NZ_CP017921.1 | Methanohalophilus halophilus |
++ More..