Result : Q8KCB8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L21 |
| NCBI Accession ID | AE006470.1 |
| Organism | Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) (Chlorobium tepidum) |
| Left | 1412295 |
| Right | 1412582 |
| Strand | + |
| Nucleotide Sequence | ATGCAGGCGCTGATCGAGATTTCCGACAAACAGTATCTGGTAAAAGCGGGCGACAAGATTTTTGTTCCCAAGCAGAAGGCCGCCGCGGGCGACGTTATCGAAGTGAAGACTCTCATGCAGGTCAATCAGGCGGATTCGGCCCTGAAAGCAGGCACCGCAACGATCAAAGTTCTTGAACACGTCAGGGACGAGACCATCATCGTCTTCCGCAAAAAACGCCGCAAACGTTTCCAGAAACGCAATGGACACCGCCAGCACATGACCCAGGTCGAAGTGCTGTCACTCTGA |
| Sequence | MQALIEISDKQYLVKAGDKIFVPKQKAAAGDVIEVKTLMQVNQADSALKAGTATIKVLEHVRDETIIVFRKKRRKRFQKRNGHRQHMTQVEVLSL |
| Source of smORF | Swiss-Prot |
| Function | This protein binds to 23S rRNA in the presence of protein L20. {ECO:0000255|HAMAP-Rule:MF_01363}. |
| Pubmed ID | 12093901 |
| Domain | CDD:412347 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q8KCB8 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1412295 | 1412582 | + | NC_002932.3 | Chlorobaculum tepidum TLS |
| 2 | 713271 | 713558 | - | NZ_CP017305.1 | Chlorobaculum limnaeum |
| 3 | 1744806 | 1745093 | + | NC_011027.1 | Chlorobaculum parvum NCIB 8327 |
| 4 | 1746019 | 1746309 | + | NC_011059.1 | Prosthecochloris aestuarii DSM 271 |
| 5 | 1065873 | 1066163 | - | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
| 6 | 1698152 | 1698442 | + | NC_007512.1 | Pelodictyon luteolum DSM 273 |
| 7 | 1883976 | 1884266 | + | NC_010803.1 | Chlorobium limicola DSM 245 |
| 8 | 2206037 | 2206327 | + | NC_008639.1 | Chlorobium phaeobacteroides DSM 266 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002932.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00664.25 | 0.62 | 5 | 4858 | same-strand | ABC transporter transmembrane region |
| 2 | PF00005.29 | 0.62 | 5 | 4858 | same-strand | ABC transporter |
| 3 | PF04055.23 | 1.0 | 8 | 3368.0 | opposite-strand | Radical SAM superfamily |
| 4 | PF00488.23 | 1.0 | 8 | 704.0 | opposite-strand | MutS domain V |
| 5 | PF05192.20 | 0.88 | 7 | 698 | opposite-strand | MutS domain III |
| 6 | PF01624.22 | 1.0 | 8 | 704.0 | opposite-strand | MutS domain I |
| 7 | PF05190.20 | 0.88 | 7 | 698 | opposite-strand | MutS family domain IV |
| 8 | PF05188.19 | 1.0 | 8 | 704.0 | opposite-strand | MutS domain II |
| 9 | PF01016.21 | 0.88 | 7 | 38 | same-strand | Ribosomal L27 protein |
| 10 | PF00056.25 | 1.0 | 8 | 542.0 | same-strand | lactate/malate dehydrogenase, NAD binding domain |
| 11 | PF02866.20 | 1.0 | 8 | 542.0 | same-strand | lactate/malate dehydrogenase, alpha/beta C-terminal domain |
| 12 | PF04371.17 | 0.75 | 6 | 2066.5 | opposite-strand | Porphyromonas-type peptidyl-arginine deiminase |
| 13 | PF16491.7 | 0.62 | 5 | 3124 | opposite-strand | CAAX prenyl protease N-terminal, five membrane helices |
| 14 | PF01435.20 | 0.62 | 5 | 3124 | opposite-strand | Peptidase family M48 |
++ More..