Result : Q8KAI0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L29 |
| NCBI Accession ID | AE006470.1 |
| Organism | Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) (Chlorobium tepidum) |
| Left | 2059705 |
| Right | 2059911 |
| Strand | - |
| Nucleotide Sequence | ATGAAAAACTATGAAATAGCGGCCATGGACAAAAAAGAGCTCCTCTCAAAGATTAAAGAGCTCGAAAACAGACTGGCCGATCTCAACTTTTACCAGGCGATCGAACCGGCGCAGAACCCGATGGTGTTCCGTAATTTGAAGCGGGATATCGCCCGGATGAAAACCAGGCTCACCCAGATCGACAGGCAGGAAAAAAGCAACGCCTGA |
| Sequence | MKNYEIAAMDKKELLSKIKELENRLADLNFYQAIEPAQNPMVFRNLKRDIARMKTRLTQIDRQEKSNA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09943. Profile Description: N/A. This family represents the N-terminal region (approximately 8 residues) of the eukaryotic mitochondrial 39-S ribosomal protein L47 (MRP-L47). Mitochondrial ribosomal proteins (MRPs) are the counterparts of the cytoplasmic ribosomal proteins, in that they fulfil similar functions in protein biosynthesis. However, they are distinct in number, features and primary structure. |
| Pubmed ID | 12093901 |
| Domain | CDD:415815 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q8KAI0 |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2059705 | 2059911 | - | NC_002932.3 | Chlorobaculum tepidum TLS |
| 2 | 2673961 | 2674167 | - | NZ_CP017305.1 | Chlorobaculum limnaeum |
| 3 | 194240 | 194446 | + | NC_011027.1 | Chlorobaculum parvum NCIB 8327 |
| 4 | 2243955 | 2244161 | - | NC_011059.1 | Prosthecochloris aestuarii DSM 271 |
| 5 | 292266 | 292472 | + | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
| 6 | 2793893 | 2794099 | - | NC_008639.1 | Chlorobium phaeobacteroides DSM 266 |
| 7 | 192461 | 192667 | + | NC_007512.1 | Pelodictyon luteolum DSM 273 |
| 8 | 2452415 | 2452621 | - | NC_010803.1 | Chlorobium limicola DSM 245 |
| 9 | 1298946 | 1299140 | + | NC_011026.1 | Chloroherpeton thalassium ATCC 35110 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002932.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00253.23 | 1.0 | 9 | 1765 | same-strand | Ribosomal protein S14p/S29e |
| 2 | PF00673.23 | 1.0 | 9 | 1163 | same-strand | ribosomal L5P family C-terminus |
| 3 | PF00281.21 | 1.0 | 9 | 1163 | same-strand | Ribosomal protein L5 |
| 4 | PF00467.31 | 1.0 | 9 | 858 | same-strand | KOW motif |
| 5 | PF00238.21 | 1.0 | 9 | 372 | same-strand | Ribosomal protein L14p/L23e |
| 6 | PF00366.22 | 1.0 | 9 | 45 | same-strand | Ribosomal protein S17 |
| 7 | PF00252.20 | 1.0 | 9 | 31 | same-strand | Ribosomal protein L16p/L10e |
| 8 | PF00189.22 | 1.0 | 9 | 498 | same-strand | Ribosomal protein S3, C-terminal domain |
| 9 | PF07650.19 | 1.0 | 9 | 498 | same-strand | KH domain |
| 10 | PF00237.21 | 1.0 | 9 | 1278 | same-strand | Ribosomal protein L22p/L17e |
| 11 | PF00203.23 | 1.0 | 9 | 1664 | same-strand | Ribosomal protein S19 |
| 12 | PF03947.20 | 0.89 | 8 | 1997.0 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 13 | PF00181.25 | 0.89 | 8 | 1997.0 | same-strand | Ribosomal Proteins L2, RNA binding domain |
++ More..