Protein Information |
Information Type | Description |
---|---|
Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
NCBI Accession ID | AE006470.1 |
Organism | Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) (Chlorobium tepidum) |
Left | 2083559 |
Right | 2083846 |
Strand | + |
Nucleotide Sequence | ATGCCCGCTTCAAGCAAATCCCGCACAAGTGCCGTGCCGACCATCGAAGAGCTGATCCAGCGCCTCGAAGAGATCACCCGGAACATCGAAAACCCGGACACCGGGCTTGAAAACTCCATCGCGCTTTACGAGGAGGGAATGTCGCTCGCCGAGGAGTGCCGTAAGCGCTTGCTGGAGACCCGCAAGAAGCTTGAAACGATCAACCCCGCCGAGACCGCCCGGCCCGCCAAACCTGAAAACGCTCCCGAAAGCCCCCGCATGAACGATCTGTTCGGCACGGAGAGCTGA |
Sequence | MPASSKSRTSAVPTIEELIQRLEEITRNIENPDTGLENSIALYEEGMSLAEECRKRLLETRKKLETINPAETARPAKPENAPESPRMNDLFGTES |
Source of smORF | Swiss-Prot |
Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
Pubmed ID | 12093901 |
Domain | CDD:412547 |
Functional Category | Others |
Uniprot ID | Q8KAE9 |
ORF Length (Amino Acid) | 95 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2083559 | 2083846 | + | NC_002932.3 | Chlorobaculum tepidum TLS |
2 | 2770946 | 2771242 | - | NZ_CP017305.1 | Chlorobaculum limnaeum |
3 | 167621 | 167923 | - | NC_011027.1 | Chlorobaculum parvum NCIB 8327 |
4 | 2820393 | 2820662 | + | NC_008639.1 | Chlorobium phaeobacteroides DSM 266 |
5 | 246381 | 246638 | - | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
6 | 2262875 | 2263126 | + | NC_011059.1 | Prosthecochloris aestuarii DSM 271 |
7 | 2519974 | 2520240 | + | NC_010803.1 | Chlorobium limicola DSM 245 |
8 | 171696 | 171953 | - | NC_007512.1 | Pelodictyon luteolum DSM 273 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00535.28 | 1.0 | 8 | 3024.5 | opposite-strand | Glycosyl transferase family 2 |
2 | PF13641.8 | 1.0 | 8 | 3024.5 | opposite-strand | Glycosyltransferase like family 2 |
3 | PF13632.8 | 0.88 | 7 | 3013 | opposite-strand | Glycosyl transferase family group 2 |
4 | PF00534.22 | 1.0 | 8 | 1939.5 | opposite-strand | Glycosyl transferases group 1 |
5 | PF13692.8 | 1.0 | 8 | 1939.5 | opposite-strand | Glycosyl transferases group 1 |
6 | PF00381.21 | 1.0 | 8 | 1593.0 | opposite-strand | PTS HPr component phosphorylation site |
7 | PF13508.9 | 1.0 | 8 | 1086.0 | opposite-strand | Acetyltransferase (GNAT) domain |
8 | PF01018.24 | 1.0 | 8 | 76.5 | opposite-strand | GTP1/OBG |
9 | PF01926.25 | 1.0 | 8 | 76.5 | opposite-strand | 50S ribosome-binding GTPase |
10 | PF02421.20 | 0.75 | 6 | 79.0 | opposite-strand | Ferrous iron transport protein B |
11 | PF02934.17 | 1.0 | 8 | 7.0 | opposite-strand | GatB/GatE catalytic domain |
12 | PF02637.20 | 1.0 | 8 | 7.0 | opposite-strand | GatB domain |
13 | PF13439.8 | 0.62 | 5 | 1914 | opposite-strand | Glycosyltransferase Family 4 |