Protein Information |
Information Type | Description |
---|---|
Protein name | ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) |
NCBI Accession ID | AE006470.1 |
Organism | Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) (Chlorobium tepidum) |
Left | 2099328 |
Right | 2099594 |
Strand | + |
Nucleotide Sequence | ATGGCAAGTTCAGACAAAGCCTTTACACTCGATATCGTCACGCCCCAGAAGCTCTTCTTTTCGGGAGAGATCAACAGCGTCATCGCTCCGGGTCTGAACGGTTTGTTCCAGGTTCTCAAAGGGCACGCTCCGCTGCTTGCCGCTTTGAAAAGCGGGAAAGTGCGCCTGTCGCTTTCCGACCGTTCCGAGGACACGTTCCAGATCGCCGGCGGATTCTTTGAAGTCAGCGGCAACAAGGCAATTTTGCTGACCGAAGAGGTCTCCTGA |
Sequence | MASSDKAFTLDIVTPQKLFFSGEINSVIAPGLNGLFQVLKGHAPLLAALKSGKVRLSLSDRSEDTFQIAGGFFEVSGNKAILLTEEVS |
Source of smORF | Swiss-Prot |
Function | Produces ATP from ADP in the presence of a proton gradient across the membrane. {ECO:0000250}. |
Pubmed ID | 12093901 |
Domain | CDD:421925 |
Functional Category | Others |
Uniprot ID | Q8KAC8 |
ORF Length (Amino Acid) | 88 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2099328 | 2099594 | + | NC_002932.3 | Chlorobaculum tepidum TLS |
2 | 2481954 | 2482220 | + | NZ_CP017305.1 | Chlorobaculum limnaeum |
3 | 49326 | 49589 | - | NC_011027.1 | Chlorobaculum parvum NCIB 8327 |
4 | 25266 | 25532 | - | NC_007512.1 | Pelodictyon luteolum DSM 273 |
5 | 50094 | 50360 | - | NC_008639.1 | Chlorobium phaeobacteroides DSM 266 |
6 | 31832 | 32098 | - | NC_010803.1 | Chlorobium limicola DSM 245 |
7 | 52933 | 53199 | - | NC_011059.1 | Prosthecochloris aestuarii DSM 271 |
8 | 45005 | 45271 | - | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
9 | 562956 | 563186 | - | NC_011026.1 | Chloroherpeton thalassium ATCC 35110 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03349.18 | 0.67 | 6 | 4732.0 | opposite-strand | Outer membrane protein transport protein (OMPP1/FadL/TodX) |
2 | PF00821.20 | 0.89 | 8 | 2458.0 | opposite-strand | Phosphoenolpyruvate carboxykinase C-terminal P-loop domain |
3 | PF17297.4 | 0.89 | 8 | 2458.0 | opposite-strand | Phosphoenolpyruvate carboxykinase N-terminal domain |
4 | PF08534.12 | 0.89 | 8 | 1780.0 | opposite-strand | Redoxin |
5 | PF00578.23 | 0.89 | 8 | 1780.0 | opposite-strand | AhpC/TSA family |
6 | PF13905.8 | 0.89 | 8 | 1780.0 | opposite-strand | Thioredoxin-like |
7 | PF13098.8 | 0.89 | 8 | 1780.0 | opposite-strand | Thioredoxin-like domain |
8 | PF00006.27 | 1.0 | 9 | 16 | same-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
9 | PF02874.25 | 1.0 | 9 | 16 | same-strand | ATP synthase alpha/beta family, beta-barrel domain |
10 | PF02016.17 | 1.0 | 9 | 55 | same-strand | LD-carboxypeptidase N-terminal domain |
11 | PF17676.3 | 1.0 | 9 | 55 | same-strand | LD-carboxypeptidase C-terminal domain |