Result : Q8KA03
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L25 |
| NCBI Accession ID | AE013218.1 |
| Organism | Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) |
| Left | 145504 |
| Right | 145794 |
| Strand | + |
| Nucleotide Sequence | ATGTTTATAGTCAAAGCGGAAATAAGAGATAAAAAAGGTAAGAGTTTTAGTAGAAAATTACGTATAGAAGATAAATTTCCAGGAGTTTTATACGGTTTTAACAATACTCCCATATCCATTACAATGGATCATAATTTAGTTTTTAATTTGCAAAAAAAAGAAGATTTTTATAAAGAAACTTTATGTTTATTAATAAAAGAAAAAAAATATACAGTAAAAGTGCACGCTATACAACGGCATGCATTCAAAATGAAGATATTACATATTGATTTTATTTATGCGAAGATCTAG |
| Sequence | MFIVKAEIRDKKGKSFSRKLRIEDKFPGVLYGFNNTPISITMDHNLVFNLQKKEDFYKETLCLLIKEKKYTVKVHAIQRHAFKMKILHIDFIYAKI |
| Source of smORF | Swiss-Prot |
| Function | This is one of the proteins that binds to the 5S RNA in the ribosome where it forms part of the central protuberance. {ECO:0000255|HAMAP-Rule:MF_01336}. |
| Pubmed ID | 12089438 |
| Domain | CDD:412568 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q8KA03 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 779367 | 779651 | - | NZ_CP009056.1 | Frischella perrara |
| 2 | 1339750 | 1340034 | - | NZ_LS483470.1 | Leminorella richardii |
| 3 | 3435713 | 3436003 | + | NZ_CP023009.1 | Lonsdalea britannica |
| 4 | 2002493 | 2002777 | - | NZ_CP009125.1 | Pectobacterium atrosepticum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LS483470.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07208.13 | 0.75 | 3 | 2545 | same-strand | Protein of unknown function (DUF1414) |
| 2 | PF04245.15 | 0.75 | 3 | 1332 | opposite-strand | 37-kD nucleoid-associated bacterial protein |
| 3 | PF04851.17 | 0.75 | 3 | 139 | same-strand | Type III restriction enzyme, res subunit |
| 4 | PF00271.33 | 0.75 | 3 | 139 | same-strand | Helicase conserved C-terminal domain |
| 5 | PF00270.31 | 0.75 | 3 | 139 | same-strand | DEAD/DEAH box helicase |
| 6 | PF00849.24 | 0.75 | 3 | 2320 | opposite-strand | RNA pseudouridylate synthase |
| 7 | PF01479.27 | 0.75 | 3 | 2320 | opposite-strand | S4 domain |
| 8 | PF13989.8 | 0.75 | 3 | 4684 | opposite-strand | YejG-like protein |
++ More..