Result : Q8GR69
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | D-alanyl carrier protein (DCP) (D-alanine--poly(phosphoribitol) ligase subunit 2) |
| NCBI Accession ID | AB091384.1 |
| Organism | Abiotrophia defectiva (Streptococcus defectivus) |
| Left | 35 |
| Right | 274 |
| Strand | - |
| Nucleotide Sequence | ATGGAAGAACAAGTATTAAGCCTTCTAGAAGAATTGTGTGAAGATGAAGTGGTTCGTGAGGATTTGGATATCAATCTCCGCGACGAAGGGCTCTTGGATTCCTTAGGTTTCGTTGAAATGCTAGTGCGGATGGAAGAAGTCTTCGGCTTCGCAACGGCGCCAACAGAAGTCACCTATGAAGAGATTGATACGCCACGCCGGGTCATGGCTTACGTTAAGAAACGAGTGGCTGCTTTATGA |
| Sequence | MEEQVLSLLEELCEDEVVREDLDINLRDEGLLDSLGFVEMLVRMEEVFGFATAPTEVTYEEIDTPRRVMAYVKKRVAAL |
| Source of smORF | Swiss-Prot |
| Function | Carrier protein involved in the D-alanylation of lipoteichoic acid (LTA). The loading of thioester-linked D-alanine onto DltC is catalyzed by D-alanine--D-alanyl carrier protein ligase DltA. The DltC-carried D-alanyl group is further transferred to cell membrane phosphatidylglycerol (PG) by forming an ester bond, probably catalyzed by DltD. D-alanylation of LTA plays an important role in modulating the properties of the cell wall in Gram-positive bacteria, influencing the net charge of the cell wall. {ECO:0000255|HAMAP-Rule:MF_00565}. |
| Pubmed ID | |
| Domain | CDD:415812 |
| Functional Category | Others |
| Uniprot ID | Q8GR69 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1399370 | 1399609 | + | NZ_CP053988.1 | Abiotrophia defectiva |
| 2 | 1528254 | 1528466 | - | NZ_CP046314.1 | Gemella morbillorum |
| 3 | 1312701 | 1312910 | - | NZ_LR134484.1 | Gemella haemolysans |
| 4 | 965681 | 965911 | - | NZ_CP039126.1 | Blautia producta |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP053988.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00501.30 | 1.0 | 4 | 1204.0 | same-strand | AMP-binding enzyme |
| 2 | PF13193.8 | 1.0 | 4 | 1204.0 | same-strand | AMP-binding enzyme C-terminal domain |
| 3 | PF04914.14 | 1.0 | 4 | 3.5 | same-strand | DltD protein |
| 4 | PF00756.22 | 0.75 | 3 | 1495 | same-strand | Putative esterase |
++ More..