Protein Information |
Information Type | Description |
---|---|
Protein name | D-alanyl carrier protein (DCP) (D-alanine--poly(phosphoribitol) ligase subunit 2) |
NCBI Accession ID | AB091384.1 |
Organism | Abiotrophia defectiva (Streptococcus defectivus) |
Left | 35 |
Right | 274 |
Strand | - |
Nucleotide Sequence | ATGGAAGAACAAGTATTAAGCCTTCTAGAAGAATTGTGTGAAGATGAAGTGGTTCGTGAGGATTTGGATATCAATCTCCGCGACGAAGGGCTCTTGGATTCCTTAGGTTTCGTTGAAATGCTAGTGCGGATGGAAGAAGTCTTCGGCTTCGCAACGGCGCCAACAGAAGTCACCTATGAAGAGATTGATACGCCACGCCGGGTCATGGCTTACGTTAAGAAACGAGTGGCTGCTTTATGA |
Sequence | MEEQVLSLLEELCEDEVVREDLDINLRDEGLLDSLGFVEMLVRMEEVFGFATAPTEVTYEEIDTPRRVMAYVKKRVAAL |
Source of smORF | Swiss-Prot |
Function | Carrier protein involved in the D-alanylation of lipoteichoic acid (LTA). The loading of thioester-linked D-alanine onto DltC is catalyzed by D-alanine--D-alanyl carrier protein ligase DltA. The DltC-carried D-alanyl group is further transferred to cell membrane phosphatidylglycerol (PG) by forming an ester bond, probably catalyzed by DltD. D-alanylation of LTA plays an important role in modulating the properties of the cell wall in Gram-positive bacteria, influencing the net charge of the cell wall. {ECO:0000255|HAMAP-Rule:MF_00565}. |
Pubmed ID | |
Domain | CDD:415812 |
Functional Category | Others |
Uniprot ID | Q8GR69 |
ORF Length (Amino Acid) | 79 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1399370 | 1399609 | + | NZ_CP053988.1 | Abiotrophia defectiva |
2 | 1528254 | 1528466 | - | NZ_CP046314.1 | Gemella morbillorum |
3 | 1312701 | 1312910 | - | NZ_LR134484.1 | Gemella haemolysans |
4 | 965681 | 965911 | - | NZ_CP039126.1 | Blautia producta |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00501.30 | 1.0 | 4 | 1204.0 | same-strand | AMP-binding enzyme |
2 | PF13193.8 | 1.0 | 4 | 1204.0 | same-strand | AMP-binding enzyme C-terminal domain |
3 | PF04914.14 | 1.0 | 4 | 3.5 | same-strand | DltD protein |
4 | PF00756.22 | 0.75 | 3 | 1495 | same-strand | Putative esterase |