Result : Q8GHK8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Probable [Fe-S]-dependent transcriptional repressor |
| NCBI Accession ID | AB089611.1 |
| Organism | Serratia marcescens |
| Left | 1774 |
| Right | 2001 |
| Strand | - |
| Nucleotide Sequence | ATGGCCGGGCTGCTGCAGGTGCGCGATGCGTTGGCGCTGCGCGCGACGTCAGGCGCACAGCTCAGCCAATCGCTGGCGACGCCGCTGCCGCTGGTGCAGGCGATGCTGGACCGTTTGACGGCGATGGGGAAAGTGGAACGCATCGAACAGGATGACGGCGCCTGTCTGAGCGGCGGCTGCAAAAGCTGCCCGCAGCCAAGGGGTGCAGCACGGTGTTCTACCGGCTGA |
| Sequence | MAGLLQVRDALALRATSGAQLSQSLATPLPLVQAMLDRLTAMGKVERIEQDDGACLSGGCKSCPQPRGAARCSTG |
| Source of smORF | Swiss-Prot |
| Function | May function as a transcriptional regulator that controls feoABC expression. {ECO:0000255|HAMAP-Rule:MF_01586}. |
| Pubmed ID | 12527210 |
| Domain | CDD:419903 |
| Functional Category | DNA-binding_and_Metal-binding |
| Uniprot ID | Q8GHK8 |
| ORF Length (Amino Acid) | 75 |
++ More..
| Conservation Analysis |
No. of Species: 80
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4928215 | 4928454 | + | NZ_CP038662.1 | Serratia nematodiphila |
| 2 | 260316 | 260555 | - | NZ_CP071320.1 | Serratia ureilytica |
| 3 | 4154751 | 4154990 | + | NZ_CP016948.1 | Serratia surfactantfaciens |
| 4 | 4891716 | 4891955 | + | NZ_LT906479.1 | Serratia ficaria |
| 5 | 5088396 | 5088635 | + | NC_015567.1 | Serratia plymuthica AS9 |
| 6 | 4972276 | 4972518 | + | NZ_CP048784.1 | Serratia liquefaciens |
| 7 | 5026691 | 5026930 | + | NZ_LR134494.1 | Serratia quinivorans |
| 8 | 59323 | 59571 | - | NZ_CP046293.1 | Yersinia intermedia |
| 9 | 1307829 | 1308068 | - | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 10 | 4445742 | 4445984 | + | NZ_CP043727.1 | Yersinia canariae |
| 11 | 2665211 | 2665459 | + | NZ_CP009787.1 | Yersinia rohdei |
| 12 | 1357911 | 1358168 | + | NZ_CP007230.1 | Yersinia similis |
| 13 | 4457311 | 4457559 | + | NZ_CP032487.1 | Yersinia hibernica |
| 14 | 258813 | 259061 | - | NZ_CP011118.1 | Yersinia enterocolitica |
| 15 | 229568 | 229825 | - | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 16 | 2929536 | 2929784 | - | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 17 | 2442086 | 2442328 | - | NZ_CP011078.1 | Yersinia ruckeri |
| 18 | 158958 | 159194 | - | NZ_CP023525.1 | Cedecea neteri |
| 19 | 2079724 | 2079963 | + | NZ_CP014136.1 | Gibbsiella quercinecans |
| 20 | 1415020 | 1415259 | + | NZ_CP011254.1 | Serratia fonticola |
| 21 | 315241 | 315480 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 22 | 1199489 | 1199728 | + | NZ_CP065640.1 | Serratia rubidaea |
| 23 | 163601 | 163837 | - | NZ_LR134201.1 | Cedecea lapagei |
| 24 | 4045541 | 4045777 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 25 | 4700567 | 4700803 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 26 | 2105900 | 2106136 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 27 | 2444890 | 2445126 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 28 | 4380237 | 4380473 | + | NC_015968.1 | Enterobacter soli |
| 29 | 200610 | 200846 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 30 | 4027034 | 4027270 | + | NZ_LR134340.1 | Escherichia marmotae |
| 31 | 3542728 | 3542964 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 32 | 4255031 | 4255267 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 33 | 3499310 | 3499546 | + | NZ_AP014857.1 | Escherichia albertii |
| 34 | 4352375 | 4352611 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 35 | 2747806 | 2748042 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 36 | 2328034 | 2328270 | + | NZ_CP033744.1 | Citrobacter freundii |
| 37 | 361911 | 362147 | - | NZ_CP050508.1 | Raoultella terrigena |
| 38 | 3753197 | 3753433 | - | NZ_CP038469.1 | Citrobacter tructae |
| 39 | 89219 | 89455 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 40 | 4263512 | 4263748 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 41 | 3511995 | 3512231 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 42 | 2040485 | 2040721 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 43 | 3976369 | 3976605 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 44 | 376003 | 376239 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 45 | 152703 | 152939 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 46 | 3069849 | 3070085 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 47 | 3722702 | 3722938 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 48 | 2927302 | 2927541 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 49 | 4364725 | 4364964 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 50 | 3961800 | 3962036 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 51 | 4470471 | 4470710 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 52 | 1593058 | 1593294 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 53 | 2934730 | 2934969 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 54 | 4930481 | 4930720 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 55 | 359944 | 360180 | - | NZ_CP041247.1 | Raoultella electrica |
| 56 | 1318332 | 1318568 | + | NZ_CP026047.1 | Raoultella planticola |
| 57 | 4248448 | 4248684 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 58 | 1115016 | 1115255 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 59 | 788739 | 788978 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 60 | 360506 | 360745 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 61 | 370040 | 370279 | - | NZ_CP054254.1 | Klebsiella variicola |
| 62 | 380284 | 380523 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 63 | 4433607 | 4433843 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 64 | 398225 | 398461 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 65 | 1515710 | 1515946 | + | NZ_CP053416.1 | Salmonella bongori |
| 66 | 4666033 | 4666269 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 67 | 4129052 | 4129288 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 68 | 4947015 | 4947254 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 69 | 209359 | 209595 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 70 | 158144 | 158383 | - | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
| 71 | 353198 | 353434 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 72 | 3188 | 3424 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 73 | 342158 | 342394 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 74 | 160962 | 161201 | - | NC_012962.1 | Photorhabdus asymbiotica |
| 75 | 1338655 | 1338885 | + | NZ_CP026364.1 | Proteus hauseri |
| 76 | 249777 | 250013 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 77 | 387805 | 388041 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 78 | 3720006 | 3720236 | + | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 79 | 346703 | 346942 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 80 | 3206146 | 3206379 | + | NC_010554.1 | Proteus mirabilis HI4320 |
| 81 | 211613 | 211852 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015567.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03449.17 | 0.9 | 72 | 5476 | same-strand | Transcription elongation factor, N-terminal |
| 2 | PF01272.21 | 0.9 | 72 | 5476 | same-strand | Transcription elongation factor, GreA/GreB, C-term |
| 3 | PF09371.12 | 0.93 | 74 | 3009 | same-strand | Tex-like protein N-terminal domain |
| 4 | PF16921.7 | 0.93 | 74 | 3009 | same-strand | Tex protein YqgF-like domain |
| 5 | PF12836.9 | 0.93 | 74 | 3009 | same-strand | Helix-hairpin-helix motif |
| 6 | PF00575.25 | 0.93 | 74 | 3009 | same-strand | S1 RNA binding domain |
| 7 | PF17674.3 | 0.93 | 74 | 3009 | same-strand | HHH domain |
| 8 | PF14635.8 | 0.93 | 74 | 3009 | same-strand | Helix-hairpin-helix motif |
| 9 | PF02421.20 | 1.0 | 80 | 10 | same-strand | Ferrous iron transport protein B |
| 10 | PF07670.16 | 1.0 | 80 | 10 | same-strand | Nucleoside recognition |
| 11 | PF07664.14 | 1.0 | 80 | 10 | same-strand | Ferrous iron transport protein B C terminus |
| 12 | PF01926.25 | 1.0 | 80 | 10 | same-strand | 50S ribosome-binding GTPase |
| 13 | PF17910.3 | 0.88 | 70 | 10 | same-strand | FeoB cytosolic helical domain |
| 14 | PF00561.22 | 0.93 | 74 | 478 | opposite-strand | alpha/beta hydrolase fold |
| 15 | PF12697.9 | 0.94 | 75 | 478.0 | opposite-strand | Alpha/beta hydrolase family |
| 16 | PF12146.10 | 0.91 | 73 | 477.5 | opposite-strand | Serine aminopeptidase, S33 |
| 17 | PF01106.19 | 0.89 | 71 | 2018.0 | same-strand | NifU-like domain |
| 18 | PF01521.22 | 0.89 | 71 | 2018.0 | same-strand | Iron-sulphur cluster biosynthesis |
| 19 | PF00072.26 | 0.7 | 56 | 6145 | opposite-strand | Response regulator receiver domain |
| 20 | PF00486.30 | 0.7 | 56 | 6145 | opposite-strand | Transcriptional regulatory protein, C terminal |
++ More..