Result : Q8G509
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0237 protein BL1209.1 |
| NCBI Accession ID | AE014295.3 |
| Organism | Bifidobacterium longum (strain NCC 2705) |
| Left | 1091376 |
| Right | 1091648 |
| Strand | - |
| Nucleotide Sequence | ATGAACAAGGCAATCATCACCGTCGTCGGTCAGGACACCGTCGGCATCATCGCGCGAGTCTGCACCTACCTGTCCCAGCACAACGTCAACGTGCTCGACATCTCGCAGACCATCATCGACGGTTACTTCAACATGATGATGATTGTCGACTACGCCAACGCGGACAAGGACTTCGGCGCGATGGTCGGCAACCTTGAGGACCTCGGCGACGACATCGGCGTGCGCATCCGCTGCCAGCGTGAGGAAATCTTCACCAAGATGCACCGTATTTGA |
| Sequence | MNKAIITVVGQDTVGIIARVCTYLSQHNVNVLDISQTIIDGYFNMMMIVDYANADKDFGAMVGNLEDLGDDIGVRIRCQREEIFTKMHRI |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09141. Profile Description: ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme. The ACT domain is a structural motif of 70-90 amino acids that functions in the control of metabolism, solute transport and signal transduction. They are thus found in a variety of different proteins in a variety of different arrangements. In mammalian phenylalanine hydroxylase the domain forms no contacts but promotes an allosteric effect despite the apparent lack of ligand binding. |
| Pubmed ID | 12381787 |
| Domain | CDD:415594 |
| Functional Category | Others |
| Uniprot ID | Q8G509 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 92
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 540573 | 540845 | + | NZ_CP026999.1 | Bifidobacterium longum |
| 2 | 555176 | 555448 | + | NZ_CP006712.1 | Bifidobacterium breve JCM 7017 |
| 3 | 2494007 | 2494279 | - | NZ_AP012331.1 | Bifidobacterium scardovii JCM 12489 = DSM 13734 |
| 4 | 2040595 | 2040867 | - | NZ_AP012326.1 | Bifidobacterium dentium JCM 1195 = DSM 20436 |
| 5 | 1646107 | 1646379 | - | NZ_AP012325.1 | Bifidobacterium catenulatum DSM 16992 = JCM 1194 = LMG 11043 |
| 6 | 1747667 | 1747939 | - | NZ_CP025199.1 | Bifidobacterium pseudocatenulatum |
| 7 | 1755842 | 1756114 | - | NZ_CP028341.1 | Bifidobacterium adolescentis |
| 8 | 1589782 | 1590054 | - | NZ_AP012322.1 | Bifidobacterium angulatum DSM 20098 = JCM 7096 |
| 9 | 517526 | 517798 | + | NZ_LR134379.1 | Slackia heliotrinireducens |
| 10 | 237363 | 237635 | - | NZ_CP018044.1 | Bifidobacterium choerinum |
| 11 | 440426 | 440698 | - | NZ_CP062948.1 | Bifidobacterium lemurum |
| 12 | 1612966 | 1613238 | - | NZ_CP022544.1 | Bifidobacterium pseudolongum |
| 13 | 2416533 | 2416805 | + | NZ_CP062938.1 | Bifidobacterium eulemuris |
| 14 | 2530385 | 2530657 | - | NC_014507.1 | Methanolacinia petrolearia DSM 11571 |
| 15 | 2590603 | 2590875 | - | NC_018227.2 | Methanoculleus bourgensis MS2 |
| 16 | 2038205 | 2038477 | + | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 17 | 9860 | 10132 | + | NZ_AP019781.1 | Methanoculleus chikugoensis |
| 18 | 2255110 | 2255382 | + | NC_009051.1 | Methanoculleus marisnigri JR1 |
| 19 | 530277 | 530549 | + | NC_018720.1 | Bifidobacterium asteroides PRL2011 |
| 20 | 343376 | 343648 | + | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 21 | 1040408 | 1040680 | - | NC_008942.1 | Methanocorpusculum labreanum Z |
| 22 | 2930512 | 2930784 | - | NC_007796.1 | Methanospirillum hungatei JF-1 |
| 23 | 1293007 | 1293279 | + | NZ_AP012334.1 | Scardovia inopinata JCM 12537 |
| 24 | 1441349 | 1441621 | + | NZ_AP012333.1 | Parascardovia denticolens DSM 10105 = JCM 12538 |
| 25 | 426645 | 426917 | + | NZ_CP006018.1 | Bifidobacterium indicum LMG 11587 = DSM 20214 |
| 26 | 440180 | 440452 | + | NZ_CP007287.1 | Bifidobacterium coryneforme |
| 27 | 4108988 | 4109260 | + | NC_015164.1 | Phocaeicola salanitronis DSM 18170 |
| 28 | 2230291 | 2230563 | - | NZ_CP032364.1 | Lachnoanaerobaculum umeaense |
| 29 | 3339319 | 3339591 | - | NZ_CP022464.2 | Enterocloster bolteae |
| 30 | 1972233 | 1972505 | - | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 31 | 2404175 | 2404447 | + | NZ_CP039126.1 | Blautia producta |
| 32 | 941216 | 941488 | + | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 33 | 2161736 | 2162020 | - | NZ_LR699011.1 | Roseburia hominis |
| 34 | 1795688 | 1795960 | + | NZ_CP030280.1 | Blautia argi |
| 35 | 1605861 | 1606133 | + | NZ_AP019309.1 | Intestinibaculum porci |
| 36 | 1080086 | 1080358 | - | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
| 37 | 1434109 | 1434381 | + | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 38 | 554794 | 555066 | + | NZ_LR215980.1 | Paraprevotella xylaniphila YIT 11841 |
| 39 | 3372429 | 3372701 | - | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 40 | 129962 | 130234 | + | NZ_CP070062.1 | Coprococcus comes |
| 41 | 4939099 | 4939371 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 42 | 3310759 | 3311007 | - | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 43 | 3406175 | 3406447 | - | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 44 | 3617755 | 3618027 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 45 | 6445563 | 6445832 | + | NZ_CP048429.1 | Paenibacillus jilunlii |
| 46 | 1094921 | 1095193 | + | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 47 | 4394573 | 4394824 | + | NZ_CP014167.1 | Paenibacillus yonginensis |
| 48 | 1671274 | 1671546 | - | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 49 | 5147862 | 5148131 | + | NZ_CP009285.1 | Paenibacillus borealis |
| 50 | 1833580 | 1833852 | + | NC_015436.1 | Sphaerochaeta coccoides DSM 17374 |
| 51 | 162205 | 162477 | - | NZ_LR130778.1 | Petrocella atlantisensis |
| 52 | 4493826 | 4494095 | + | NZ_CP009287.1 | Paenibacillus graminis |
| 53 | 6575588 | 6575857 | + | NZ_CP068595.1 | Paenibacillus sonchi |
| 54 | 4469974 | 4470222 | + | NZ_CP009428.1 | Paenibacillus odorifer |
| 55 | 5054250 | 5054519 | + | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 56 | 2351250 | 2351483 | - | NZ_CP016757.1 | Cloacibacillus porcorum |
| 57 | 3829092 | 3829325 | + | NZ_CP009288.1 | Paenibacillus durus |
| 58 | 3339781 | 3340050 | + | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 59 | 3526237 | 3526506 | + | NZ_CP009286.1 | Paenibacillus stellifer |
| 60 | 1735251 | 1735523 | - | NZ_LN879430.1 | Herbinix luporum |
| 61 | 4227255 | 4227524 | + | NZ_CP021780.1 | Paenibacillus donghaensis |
| 62 | 170166 | 170438 | + | NZ_LR698974.1 | Candidatus Methanomassiliicoccus intestinalis |
| 63 | 1239045 | 1239314 | - | NZ_CP028102.1 | Fusobacterium mortiferum ATCC 9817 |
| 64 | 2285704 | 2285973 | + | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 65 | 1475507 | 1475779 | + | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 66 | 2068132 | 2068404 | - | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 67 | 149922 | 150167 | + | NZ_CP013213.1 | Erysipelothrix larvae |
| 68 | 1568332 | 1568601 | + | NZ_LR134439.1 | Erysipelothrix rhusiopathiae |
| 69 | 2964849 | 2965118 | - | NZ_AP021853.1 | Sporolactobacillus terrae |
| 70 | 1637768 | 1638037 | + | NZ_CP060715.1 | Erysipelothrix inopinata |
| 71 | 2327389 | 2327658 | + | NZ_CP028105.1 | Fusobacterium ulcerans |
| 72 | 237020 | 237289 | - | NZ_CP028103.1 | Fusobacterium varium ATCC 27725 |
| 73 | 3353345 | 3353593 | + | NZ_CP034413.2 | Dysosmobacter welbionis |
| 74 | 579967 | 580236 | + | NZ_CP028106.1 | Fusobacterium gonidiaformans ATCC 25563 |
| 75 | 2052790 | 2053041 | + | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
| 76 | 658189 | 658422 | + | NZ_CP028107.1 | Fusobacterium necrophorum subsp. funduliforme |
| 77 | 894174 | 894467 | + | NZ_CP065993.1 | Leuconostoc pseudomesenteroides |
| 78 | 568130 | 568402 | + | NZ_CP014223.1 | Anaerotignum propionicum DSM 1682 |
| 79 | 1237902 | 1238171 | - | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 80 | 1350390 | 1350665 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 81 | 3858177 | 3858401 | + | NZ_CP048436.1 | Flavonifractor plautii |
| 82 | 1328057 | 1328305 | + | NC_015732.1 | Treponema caldarium DSM 7334 |
| 83 | 2944533 | 2944802 | - | NZ_CP011102.1 | Listeria weihenstephanensis |
| 84 | 262238 | 262516 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 85 | 2492347 | 2492616 | - | NC_014393.1 | Clostridium cellulovorans 743B |
| 86 | 2348377 | 2348610 | + | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 87 | 1802126 | 1802368 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 88 | 840000 | 840260 | + | NZ_LT906477.1 | Clostridium cochlearium |
| 89 | 374366 | 374635 | + | NZ_CP046996.1 | Dehalobacter restrictus |
| 90 | 1535235 | 1535504 | - | NC_011899.1 | Halothermothrix orenii H 168 |
| 91 | 434723 | 434992 | - | NC_015385.1 | Treponema succinifaciens DSM 2489 |
| 92 | 1826977 | 1827225 | + | NC_008593.1 | Clostridium novyi NT |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP026999.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05167.14 | 0.99 | 91 | 24 | same-strand | Uncharacterised ACR (DUF711) |
++ More..