Result : Q8FI27
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative hemolysin E-like protein |
| NCBI Accession ID | AE014075.1 |
| Organism | Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) |
| Left | 1467497 |
| Right | 1467778 |
| Strand | - |
| Nucleotide Sequence | TTGAAGAACAAGTTAAAATCTGCGCTGAGTTTCTTTACCACCCTGTCTAACACGGTTAAACAAGCGAATAAAGATATCGATGCCGCCAAATTGAAATTAACTACCGAAATAGCCGCCATCGGGGTGATAAAAACGGAAACTGAAACAACCAGATTCTACGTTGATTATGATGATTTAATGCTTTCTTTACTAAAAGAAGCGGCCCAAAAAATGATTAACACCTGTAATGAGTATCAGAAAAGACACGGTAAGAAGACACTCTTTGAGATACCTGAAGTCTGA |
| Sequence | MKNKLKSALSFFTTLSNTVKQANKDIDAAKLKLTTEIAAIGVIKTETETTRFYVDYDDLMLSLLKEAAQKMINTCNEYQKRHGKKTLFEIPEV |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 12471157 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q8FI27 |
| ORF Length (Amino Acid) | 93 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1671107 | 1671388 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 1229483 | 1229764 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 1213185 | 1213466 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05166.15 | 1.0 | 2 | 1476 | opposite-strand | YcgL domain |
| 2 | PF01557.20 | 1.0 | 2 | 745 | opposite-strand | Fumarylacetoacetate (FAA) hydrolase family |
| 3 | PF03692.17 | 1.0 | 2 | 207 | opposite-strand | Putative zinc- or iron-chelating domain |
| 4 | PF00717.25 | 1.0 | 2 | 1003 | opposite-strand | Peptidase S24-like |
| 5 | PF00817.22 | 1.0 | 2 | 1422 | opposite-strand | impB/mucB/samB family |
| 6 | PF13438.8 | 1.0 | 2 | 1422 | opposite-strand | Domain of unknown function (DUF4113) |
| 7 | PF11799.10 | 1.0 | 2 | 1422 | opposite-strand | impB/mucB/samB family C-terminal domain |
| 8 | PF11798.10 | 1.0 | 2 | 1422 | opposite-strand | IMS family HHH motif |
| 9 | PF02600.18 | 1.0 | 2 | 2736 | same-strand | Disulfide bond formation protein DsbB |
| 10 | PF06450.14 | 1.0 | 2 | 3412 | same-strand | Bacterial Na+/H+ antiporter B (NhaB) |
++ More..