Protein Information |
Information Type | Description |
---|---|
Protein name | Antitoxin HipB |
NCBI Accession ID | AE014075.1 |
Organism | Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) |
Left | 1783191 |
Right | 1783475 |
Strand | - |
Nucleotide Sequence | TTGCTGTGGACGTATGACATGATGAGCTTTCAGAAGATCTATAGCCCAACGCAATTGGCGAATGCAATGAAACTGGTTCGCCAGCAAAACGGCTGGACGCAGAGCGAGTTGGCGAAAAAAATCGGCATTAAGCAGGCGACAATTTCCAATTTCGAAAACAATCCTGACAATACCTCGCTCACGACATTTTTTAAGATTTTACAGTCGCTTGAACTCTCAATGACGCTATGCGACGCGAAAAATGCCTCGCCAGAAGCAGCAGAACAGCAAGATTTGGAGTGGTAA |
Sequence | MLWTYDMMSFQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTSLTTFFKILQSLELSMTLCDAKNASPEAAEQQDLEW |
Source of smORF | Swiss-Prot |
Function | Antitoxin component of a type II type II toxin-antitoxin (TA) system. Neutralizes the toxic effect of cognate toxin HipA. Represses the hipBA operon promoter (By similarity). {ECO:0000250|UniProtKB:P23873}. |
Pubmed ID | 12471157 23055930 |
Domain | CDD:419869 |
Functional Category | Antitoxin_type_2_and_DNA-binding |
Uniprot ID | Q8FHF3 |
ORF Length (Amino Acid) | 94 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1592176 | 1592460 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 2173878 | 2174159 | + | NZ_LR134340.1 | Escherichia marmotae |
3 | 2942869 | 2943141 | - | NZ_CP050508.1 | Raoultella terrigena |
4 | 2353916 | 2354173 | + | NC_015968.1 | Enterobacter soli |
5 | 4451750 | 4452022 | + | NZ_CP026047.1 | Raoultella planticola |
6 | 2808717 | 2808989 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
7 | 2625643 | 2625915 | - | NZ_CP041247.1 | Raoultella electrica |
8 | 2069120 | 2069368 | + | NZ_CP038853.1 | Pantoea vagans |
9 | 2726204 | 2726470 | - | NZ_CP054254.1 | Klebsiella variicola |
10 | 2618696 | 2618962 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
11 | 2078734 | 2078982 | + | NZ_CP045720.1 | Pantoea eucalypti |
12 | 2564293 | 2564541 | + | NZ_LT960611.1 | Vibrio tapetis subsp. tapetis |
13 | 4149030 | 4149278 | + | NZ_CP046378.1 | Shewanella algae |
14 | 2577356 | 2577622 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF07804.14 | 1.0 | 14 | 0.0 | same-strand | HipA-like C-terminal domain |
2 | PF13657.8 | 0.93 | 13 | 0 | same-strand | HipA N-terminal domain |