Result : Q8FHF3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin HipB |
| NCBI Accession ID | AE014075.1 |
| Organism | Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) |
| Left | 1783191 |
| Right | 1783475 |
| Strand | - |
| Nucleotide Sequence | TTGCTGTGGACGTATGACATGATGAGCTTTCAGAAGATCTATAGCCCAACGCAATTGGCGAATGCAATGAAACTGGTTCGCCAGCAAAACGGCTGGACGCAGAGCGAGTTGGCGAAAAAAATCGGCATTAAGCAGGCGACAATTTCCAATTTCGAAAACAATCCTGACAATACCTCGCTCACGACATTTTTTAAGATTTTACAGTCGCTTGAACTCTCAATGACGCTATGCGACGCGAAAAATGCCTCGCCAGAAGCAGCAGAACAGCAAGATTTGGAGTGGTAA |
| Sequence | MLWTYDMMSFQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTSLTTFFKILQSLELSMTLCDAKNASPEAAEQQDLEW |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II type II toxin-antitoxin (TA) system. Neutralizes the toxic effect of cognate toxin HipA. Represses the hipBA operon promoter (By similarity). {ECO:0000250|UniProtKB:P23873}. |
| Pubmed ID | 12471157 23055930 |
| Domain | CDD:419869 |
| Functional Category | Antitoxin_type_2_and_DNA-binding |
| Uniprot ID | Q8FHF3 |
| ORF Length (Amino Acid) | 94 |
++ More..
| Conservation Analysis |
No. of Species: 14
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1592176 | 1592460 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 2173878 | 2174159 | + | NZ_LR134340.1 | Escherichia marmotae |
| 3 | 2942869 | 2943141 | - | NZ_CP050508.1 | Raoultella terrigena |
| 4 | 2353916 | 2354173 | + | NC_015968.1 | Enterobacter soli |
| 5 | 4451750 | 4452022 | + | NZ_CP026047.1 | Raoultella planticola |
| 6 | 2808717 | 2808989 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 7 | 2625643 | 2625915 | - | NZ_CP041247.1 | Raoultella electrica |
| 8 | 2069120 | 2069368 | + | NZ_CP038853.1 | Pantoea vagans |
| 9 | 2726204 | 2726470 | - | NZ_CP054254.1 | Klebsiella variicola |
| 10 | 2618696 | 2618962 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 11 | 2078734 | 2078982 | + | NZ_CP045720.1 | Pantoea eucalypti |
| 12 | 2564293 | 2564541 | + | NZ_LT960611.1 | Vibrio tapetis subsp. tapetis |
| 13 | 4149030 | 4149278 | + | NZ_CP046378.1 | Shewanella algae |
| 14 | 2577356 | 2577622 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07804.14 | 1.0 | 14 | 0.0 | same-strand | HipA-like C-terminal domain |
| 2 | PF13657.8 | 0.93 | 13 | 0 | same-strand | HipA N-terminal domain |
++ More..