Result : Q8F5K6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S6 |
| NCBI Accession ID | AE010300.2 |
| Organism | Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) |
| Left | 1674586 |
| Right | 1674861 |
| Strand | + |
| Nucleotide Sequence | TTGAGAAACTACGAACTCACCACAATTACACGTGTGAGCTCTCGGGAAGTTGCAAAGTCCGAAATTCAGGAAACTTTGAAAAAACATTCCGTGAGCGTCACAGCCGAAGAAGATTGGGGCCAAAGAAAACTCTGGCATCCGATTAAACATGAAGAACAGGGAATCTTCCACCACTATAAATGTAGCGCAGATCCAAACGCCATTGAAAAAGTGGAAAAGGAATTCTTAATCAATCAAAATATTCTTCGTTCTATGGTCGTTCGCCTCCATGGCTAA |
| Sequence | MRNYELTTITRVSSREVAKSEIQETLKKHSVSVTAEEDWGQRKLWHPIKHEEQGIFHHYKCSADPNAIEKVEKEFLINQNILRSMVVRLHG |
| Source of smORF | Swiss-Prot |
| Function | Binds together with S18 to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00360}. |
| Pubmed ID | 12712204 |
| Domain | CDD:412366 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q8F5K6 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 563643 | 563918 | - | NZ_CP020414.2 | Leptospira interrogans serovar Copenhageni |
| 2 | 3288294 | 3288569 | - | NZ_CP030142.1 | Leptospira mayottensis |
| 3 | 2804095 | 2804370 | - | NZ_CP040840.1 | Leptospira weilii |
| 4 | 3865809 | 3866084 | + | NZ_CP033614.1 | Leptospira kmetyi |
| 5 | 1603339 | 1603614 | + | NZ_CP015217.1 | Leptospira tipperaryensis |
| 6 | 2510361 | 2510636 | - | NZ_CP026671.1 | Leptospira borgpetersenii serovar Ceylonica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP020414.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00152.22 | 1.0 | 6 | 2599.0 | same-strand | tRNA synthetases class II (D, K and N) |
| 2 | PF02938.16 | 1.0 | 6 | 2599.0 | same-strand | GAD domain |
| 3 | PF01336.27 | 1.0 | 6 | 2599.0 | same-strand | OB-fold nucleic acid binding domain |
| 4 | PF03796.17 | 1.0 | 6 | 1243.5 | same-strand | DnaB-like helicase C terminal domain |
| 5 | PF00772.23 | 1.0 | 6 | 1243.5 | same-strand | DnaB-like helicase N terminal domain |
| 6 | PF13481.8 | 1.0 | 6 | 1243.5 | same-strand | AAA domain |
| 7 | PF01281.21 | 1.0 | 6 | 775.0 | same-strand | Ribosomal protein L9, N-terminal domain |
| 8 | PF03948.16 | 1.0 | 6 | 775.0 | same-strand | Ribosomal protein L9, C-terminal domain |
| 9 | PF01084.22 | 1.0 | 6 | 456.0 | same-strand | Ribosomal protein S18 |
| 10 | PF00436.27 | 1.0 | 6 | -7.0 | same-strand | Single-strand binding protein family |
| 11 | PF09587.12 | 1.0 | 6 | 65.5 | same-strand | Bacterial capsule synthesis protein PGA cap |
| 12 | PF00939.21 | 0.83 | 5 | 3644 | same-strand | Sodium:sulfate symporter transmembrane region |
| 13 | PF03600.18 | 0.83 | 5 | 3644 | same-strand | Citrate transporter |
++ More..