Protein Information |
Information Type | Description |
---|---|
Protein name | 50S ribosomal protein L30 |
NCBI Accession ID | AM746676.1 |
Organism | Sorangium cellulosum (strain So ce56) (Polyangium cellulosum (strain So ce56)) |
Left | 11069274 |
Right | 11069477 |
Strand | - |
Nucleotide Sequence | GTGAAGCTCCGGGTACGTCAGAAGGCCAGCAACATCGGCCAGGTCGAGCACACCCGCAAGATCATCAAGGGGCTCGGCCTGCGTGGGCCGGGGTCCGAGGTGGTCGTCGCGAACACGCCCTCGTTCCGTGGCATGGTGAAGAAGGTCCTCCACCTCGTCGAGGTCGAGGAGGTCGCCGACGGAGCGACCTCGTCGAAGGCCTGA |
Sequence | MKLRVRQKASNIGQVEHTRKIIKGLGLRGPGSEVVVANTPSFRGMVKKVLHLVEVEEVADGATSSKA |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00203. Profile Description: N/A. This family includes prokaryotic L30 and eukaryotic L7. |
Pubmed ID | 17965706 |
Domain | CDD:412218 |
Functional Category | Ribosomal_protein |
Uniprot ID | A9FGF3 |
ORF Length (Amino Acid) | 67 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 11069274 | 11069477 | - | NC_010162.1 | Sorangium cellulosum So ce56 |
2 | 10853025 | 10853231 | + | NZ_CP016211.1 | Minicystis rosea |
3 | 9053826 | 9053996 | - | NZ_CP011125.1 | Sandaracinus amylolyticus |
4 | 1750523 | 1750690 | - | NZ_CP014681.1 | Kozakia baliensis |
5 | 354672 | 354860 | - | NZ_CP032485.1 | Neokomagataea tanensis |
6 | 2212918 | 2213082 | - | NC_012982.1 | Hirschia baltica ATCC 49814 |
7 | 821223 | 821408 | + | NZ_AP014690.1 | Asaia bogorensis NBRC 16594 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00406.24 | 1.0 | 7 | 1974 | same-strand | Adenylate kinase |
2 | PF13207.8 | 1.0 | 7 | 1974 | same-strand | AAA domain |
3 | PF00344.22 | 1.0 | 7 | 612 | same-strand | SecY |
4 | PF00828.21 | 1.0 | 7 | 2 | same-strand | Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A |
5 | PF00333.22 | 1.0 | 7 | -3 | same-strand | Ribosomal protein S5, N-terminal domain |
6 | PF03719.17 | 1.0 | 7 | -3 | same-strand | Ribosomal protein S5, C-terminal domain |
7 | PF00861.24 | 1.0 | 7 | 609 | same-strand | Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast |
8 | PF00347.25 | 1.0 | 7 | 1008 | same-strand | Ribosomal protein L6 |
9 | PF00410.21 | 1.0 | 7 | 1566 | same-strand | Ribosomal protein S8 |
10 | PF00253.23 | 1.0 | 7 | 1976 | same-strand | Ribosomal protein S14p/S29e |
11 | PF13238.8 | 0.86 | 6 | 1978.0 | same-strand | AAA domain |
12 | PF00416.24 | 0.71 | 5 | 2753 | same-strand | Ribosomal protein S13/S18 |
13 | PF13671.8 | 0.71 | 5 | 1982 | same-strand | AAA domain |