Result : Q8EYB0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Translational regulator CsrA |
| NCBI Accession ID | AE010300.2 |
| Organism | Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) |
| Left | 4288300 |
| Right | 4288554 |
| Strand | - |
| Nucleotide Sequence | GTGCTGGTTTTAGCGAGAAGAACGAACGAATCGATTATGATCGGAGACGATATAGAAATCGTCATCGTTGATATAAAAGGTGATCAGGTTAAGATTGGAGTTAAGGCGCCTAGGGATGTTTCTGTACACAGGGCTGAAGTTTATAAGGACATTCAGGAAGAAAATAAAAAAGCCGCGGAAACCAAAATAAAACCAGCAGATCTAGGTAAAATTGGAAACATTTTGAAAAAGAAAGATTCTGGAAAAAAAGAATAA |
| Sequence | MLVLARRTNESIMIGDDIEIVIVDIKGDQVKIGVKAPRDVSVHRAEVYKDIQEENKKAAETKIKPADLGKIGNILKKKDSGKKE |
| Source of smORF | Swiss-Prot |
| Function | A translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Usually binds in the 5'-UTR at or near the Shine-Dalgarno sequence preventing ribosome-binding, thus repressing translation. Its main target seems to be the major flagellin gene, while its function is anatagonized by FliW. {ECO:0000255|HAMAP-Rule:MF_00167}. |
| Pubmed ID | 12712204 |
| Domain | CDD:412510 |
| Functional Category | RNA-binding |
| Uniprot ID | Q8EYB0 |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 54
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2237947 | 2238201 | - | NZ_CP020414.2 | Leptospira interrogans serovar Copenhageni |
| 2 | 4062977 | 4063231 | - | NZ_CP015217.1 | Leptospira tipperaryensis |
| 3 | 2278457 | 2278711 | - | NZ_CP033614.1 | Leptospira kmetyi |
| 4 | 3625458 | 3625712 | - | NZ_CP026671.1 | Leptospira borgpetersenii serovar Ceylonica |
| 5 | 3912643 | 3912897 | - | NZ_CP040840.1 | Leptospira weilii |
| 6 | 1208148 | 1208402 | + | NZ_CP030142.1 | Leptospira mayottensis |
| 7 | 1309609 | 1309839 | + | NC_023035.1 | Salinispira pacifica |
| 8 | 1540467 | 1540691 | - | NC_018020.1 | Turneriella parva DSM 21527 |
| 9 | 114616 | 114834 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 10 | 2500518 | 2500775 | - | NZ_CP063458.1 | Humisphaera borealis |
| 11 | 4047032 | 4047265 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 12 | 714565 | 714786 | - | NC_015714.1 | Treponema paraluiscuniculi Cuniculi A |
| 13 | 565122 | 565340 | + | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 14 | 3092697 | 3092930 | + | NC_013720.1 | Pirellula staleyi DSM 6068 |
| 15 | 50663 | 50908 | - | NC_014330.1 | Brachyspira pilosicoli 95/1000 |
| 16 | 6523097 | 6523312 | + | NZ_CP036433.1 | Lignipirellula cremea |
| 17 | 2784134 | 2784385 | - | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 18 | 2521868 | 2522092 | - | NZ_CP036298.1 | Aureliella helgolandensis |
| 19 | 1791308 | 1791553 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 20 | 1083494 | 1083733 | + | NZ_CP026363.1 | Brevibacillus agri |
| 21 | 371180 | 371401 | + | NZ_LN879430.1 | Herbinix luporum |
| 22 | 6895443 | 6895676 | + | NZ_CP036274.1 | Anatilimnocola aggregata |
| 23 | 903031 | 903258 | + | NZ_CP036150.1 | Oceanispirochaeta crateris |
| 24 | 3436208 | 3436435 | - | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 25 | 1378361 | 1378600 | + | NC_007759.1 | Syntrophus aciditrophicus SB |
| 26 | 1150025 | 1150255 | + | NZ_CP045851.1 | Actinomarinicola tropica |
| 27 | 1963328 | 1963546 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 28 | 2612721 | 2612945 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 29 | 162405 | 162626 | + | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 30 | 286138 | 286374 | + | NZ_CP020559.1 | Clostridium formicaceticum |
| 31 | 4689439 | 4689657 | - | NZ_CP036278.1 | Aeoliella mucimassa |
| 32 | 4698768 | 4698983 | - | NZ_CP042912.1 | Mariniblastus fucicola |
| 33 | 3369879 | 3370103 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 34 | 483501 | 483731 | - | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 35 | 8460942 | 8461211 | + | NC_019892.1 | Singulisphaera acidiphila DSM 18658 |
| 36 | 240798 | 241028 | + | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 37 | 1460861 | 1461091 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 38 | 207133 | 207357 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 39 | 190154 | 190378 | + | NZ_CP019401.1 | Planococcus faecalis |
| 40 | 198739 | 198963 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 41 | 187245 | 187469 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 42 | 1498786 | 1499004 | - | NC_015385.1 | Treponema succinifaciens DSM 2489 |
| 43 | 2558080 | 2558319 | + | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 44 | 1572340 | 1572564 | - | NZ_CP013661.2 | Planococcus kocurii |
| 45 | 2811116 | 2811340 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 46 | 4471638 | 4471865 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 47 | 3344894 | 3345121 | + | NC_016620.1 | Halobacteriovorax marinus SJ |
| 48 | 1704134 | 1704355 | - | NZ_AP021861.1 | Lacipirellula parvula |
| 49 | 614490 | 614729 | + | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 50 | 4890001 | 4890219 | - | NZ_CP043998.1 | Clostridium diolis |
| 51 | 262089 | 262334 | + | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 52 | 404339 | 404572 | - | NZ_CP027432.2 | Caminibacter pacificus |
| 53 | 929606 | 929827 | + | NZ_CP031518.1 | Treponema ruminis |
| 54 | 2658041 | 2658268 | + | NZ_CP022983.1 | Cytobacillus kochii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP020414.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02623.17 | 0.96 | 52 | 3.0 | same-strand | FliW protein |
| 2 | PF00669.22 | 0.89 | 48 | 616.0 | same-strand | Bacterial flagellin N-terminal helical region |
| 3 | PF00700.23 | 0.69 | 37 | 947.0 | same-strand | Bacterial flagellin C-terminal helical region |
| 4 | PF05130.14 | 0.61 | 33 | 3759.5 | same-strand | FlgN protein |
++ More..