| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L28 |
| NCBI Accession ID | BA000026.2 |
| Organism | Mycoplasma penetrans (strain HF-2) |
| Left | 528514 |
| Right | 528762 |
| Strand | - |
| Nucleotide Sequence | ATGGCAAAAGTAGATCAAATAACTAAAAAAAGGGCAATGACTGGTAATACTCGTTCACACGCATTAAACCACAGTAGAAGAAGATGAGATTTAAACTTACAAAAAGTTAAAATCTATGATGAAAATAATAATATAGTGGAAGTGAAAGTTACTGCAAGAACTTTAAAGGGTCTAAAGAAAAATAATAAAGTGGTTAAAGTTGACTACTCAAAACCTGCTAAAGTTTATGGTCAAAACAGCCCTAAATAA |
| Sequence | MAKVDQITKKRAMTGNTRSHALNHSRRRWDLNLQKVKIYDENNNIVEVKVTARTLKGLKKNNKVVKVDYSKPAKVYGQNSPK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00367. Profile Description: Ribosomal L28 family. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture (e.g. SP|P36525 from Saccharomyces cerevisiae, which is 258 amino acids long) and are not included. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 12466555 |
| Domain | CDD:412338 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q8EW04 |
| ORF Length (Amino Acid) | 82 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 946169 | 946369 | + | NZ_CP038013.1 | Spiroplasma gladiatoris |
| 2 | 1174115 | 1174315 | - | NZ_CP042410.1 | Leuconostoc citreum |
| 3 | 1554015 | 1554215 | - | NZ_CP065993.1 | Leuconostoc pseudomesenteroides |
| 4 | 202546 | 202746 | + | NZ_CP028251.1 | Leuconostoc mesenteroides |
| 5 | 1446143 | 1446343 | - | NZ_CP015247.1 | Leuconostoc suionicum |
| 6 | 1488628 | 1488828 | + | NZ_CP042374.1 | Leuconostoc carnosum |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13684.8 | 1.0 | 6 | 571.0 | same-strand | Dihydroxyacetone kinase family |
| 2 | PF03780.15 | 1.0 | 6 | 194.0 | same-strand | Asp23 family, cell envelope-related function |
| 3 | PF02381.20 | 0.83 | 5 | 3134 | same-strand | MraZ protein, putative antitoxin-like |
| 4 | PF11877.10 | 0.67 | 4 | 2640.0 | same-strand | Protein of unknown function (DUF3397) |
| 5 | PF13253.8 | 0.83 | 5 | 2331 | opposite-strand | Protein of unknown function (DUF4044) |
| 6 | PF02734.19 | 0.83 | 5 | 577 | same-strand | DAK2 domain |
| 7 | PF00085.22 | 0.83 | 5 | 89 | same-strand | Thioredoxin |
| 8 | PF13098.8 | 0.83 | 5 | 89 | same-strand | Thioredoxin-like domain |
| 9 | PF04263.18 | 0.83 | 5 | 407 | same-strand | Thiamin pyrophosphokinase, catalytic domain |
| 10 | PF04265.16 | 0.83 | 5 | 407 | same-strand | Thiamin pyrophosphokinase, vitamin B1 binding domain |
| 11 | PF00834.21 | 0.83 | 5 | 1054 | same-strand | Ribulose-phosphate 3 epimerase family |
| 12 | PF03193.18 | 0.83 | 5 | 1724 | same-strand | RsgA GTPase |
| 13 | PF16745.7 | 0.83 | 5 | 1724 | same-strand | RsgA N-terminal domain |
| 14 | PF00069.27 | 0.83 | 5 | 2664 | same-strand | Protein kinase domain |
| 15 | PF07714.19 | 0.83 | 5 | 2664 | same-strand | Protein tyrosine and serine/threonine kinase |
| 16 | PF03793.21 | 0.83 | 5 | 2664 | same-strand | PASTA domain |