Result : Q8EVW7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L21 |
| NCBI Accession ID | BA000026.2 |
| Organism | Mycoplasma penetrans (strain HF-2) |
| Left | 579621 |
| Right | 579923 |
| Strand | + |
| Nucleotide Sequence | ATGTTTGCTATTTTTGAAGTAGGAAGTAAGCAATACAAAGTCCAAAAGGGTGATGTTATCTATGTTGAAAAACAAGATAAAAAAGTAGGTGAAAGCATCTCTTTTGATAAAGTACTAATGGTAGATGCTACTATAGGAAAGCCTTATATTAAAAATGCTACAGTTTCTTGTAAAGTTGAAAAACAAGGAAAACAAAAAAAGATTTTTATTATAAAGCATAAAAGATATACACGTTCTTTAAAAAGACAAGGTCATAGACAACCTTACACAAAATTAGTTGTTACAGGAATTAATGTAAAGTAA |
| Sequence | MFAIFEVGSKQYKVQKGDVIYVEKQDKKVGESISFDKVLMVDATIGKPYIKNATVSCKVEKQGKQKKIFIIKHKRYTRSLKRQGHRQPYTKLVVTGINVK |
| Source of smORF | Swiss-Prot |
| Function | This protein binds to 23S rRNA in the presence of protein L20. {ECO:0000255|HAMAP-Rule:MF_01363}. |
| Pubmed ID | 12466555 |
| Domain | CDD:412347 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q8EVW7 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 99
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 579621 | 579923 | + | NC_004432.1 | Mycoplasma penetrans HF-2 |
| 2 | 459699 | 460001 | + | NZ_LR215023.1 | Mycoplasma iowae |
| 3 | 242868 | 243170 | - | NC_011374.1 | Ureaplasma urealyticum serovar 10 str. ATCC 33699 |
| 4 | 255535 | 255837 | - | NC_010503.1 | Ureaplasma parvum serovar 3 str. ATCC 27815 |
| 5 | 476370 | 476672 | + | NC_018406.1 | Mycoplasma gallisepticum VA94_7994-1-7P |
| 6 | 414574 | 414876 | + | NZ_CP059674.1 | Mycoplasma tullyi |
| 7 | 1321284 | 1321586 | - | NZ_CP017326.1 | Weissella soli |
| 8 | 867385 | 867696 | + | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 9 | 938782 | 939090 | + | NZ_CP040336.1 | Bacillus luti |
| 10 | 4251773 | 4252081 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 11 | 4286750 | 4287058 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 12 | 4422084 | 4422392 | - | NC_011725.1 | Bacillus cereus B4264 |
| 13 | 4460104 | 4460412 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 14 | 462860 | 463162 | + | NZ_CP027563.1 | Weissella confusa |
| 15 | 342611 | 342913 | + | NZ_CP061835.1 | Weissella viridescens |
| 16 | 913491 | 913799 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 17 | 4255680 | 4255988 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 18 | 2944228 | 2944536 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 19 | 2812773 | 2813081 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 20 | 713801 | 714145 | + | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 21 | 2615781 | 2616089 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 22 | 1828745 | 1829053 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 23 | 3204009 | 3204317 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 24 | 198732 | 199034 | + | NZ_CP023501.1 | Weissella paramesenteroides |
| 25 | 3257177 | 3257485 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 26 | 1529636 | 1529944 | - | NZ_LR134483.1 | Listeria grayi |
| 27 | 921857 | 922159 | + | NZ_CP011391.1 | Faecalibaculum rodentium |
| 28 | 1404277 | 1404585 | + | NZ_CP016538.2 | Planococcus maritimus |
| 29 | 1414283 | 1414591 | + | NZ_CP059540.1 | Planococcus maritimus |
| 30 | 1096319 | 1096627 | + | NZ_AP019309.1 | Intestinibaculum porci |
| 31 | 3128847 | 3129155 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 32 | 1075016 | 1075324 | + | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 33 | 1203971 | 1204279 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 34 | 1643571 | 1643873 | - | NZ_CP014332.1 | Weissella jogaejeotgali |
| 35 | 232146 | 232457 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 36 | 1589845 | 1590153 | + | NZ_LS483476.1 | Lederbergia lentus |
| 37 | 3645831 | 3646139 | - | NZ_CP053989.1 | Niallia circulans |
| 38 | 1440273 | 1440581 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 39 | 1081100 | 1081408 | - | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
| 40 | 3939833 | 3940144 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 41 | 155849 | 156151 | + | NZ_LS991949.1 | Mycoplasma alkalescens |
| 42 | 1157252 | 1157560 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 43 | 2072639 | 2072947 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 44 | 1590080 | 1590388 | - | NZ_CP054482.1 | Macrococcus bohemicus |
| 45 | 3901940 | 3902248 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 46 | 1870779 | 1871087 | - | NZ_CP008876.1 | Terribacillus goriensis |
| 47 | 173202 | 173504 | - | NZ_AP014657.1 | Mycoplasmopsis arginini |
| 48 | 7278842 | 7279153 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 49 | 2334557 | 2334865 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 50 | 4415395 | 4415703 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 51 | 661173 | 661481 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 52 | 1194455 | 1194763 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 53 | 3542126 | 3542434 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 54 | 374176 | 374475 | + | NC_006908.1 | Mycoplasma mobile 163K |
| 55 | 1323290 | 1323598 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 56 | 697061 | 697360 | - | NC_014014.1 | Mycoplasma crocodyli MP145 |
| 57 | 854933 | 855241 | + | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 58 | 2252106 | 2252414 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 59 | 2720948 | 2721256 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 60 | 2612492 | 2612800 | - | NZ_CP031223.1 | Psychrobacillus glaciei |
| 61 | 1610859 | 1611167 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 62 | 1576747 | 1577055 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 63 | 430159 | 430467 | - | NZ_CP015108.1 | Sporosarcina ureae |
| 64 | 5358969 | 5359280 | - | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 65 | 2813466 | 2813777 | - | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 66 | 59935 | 60237 | - | NZ_CP033058.2 | Mycoplasma phocicerebrale |
| 67 | 987541 | 987852 | - | NZ_CP041217.1 | Saccharibacillus brassicae |
| 68 | 1489321 | 1489629 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 69 | 1553869 | 1554177 | - | NZ_LT906444.1 | Listeria welshimeri |
| 70 | 384262 | 384564 | + | NZ_CP010546.1 | Mycoplasma pneumoniae FH |
| 71 | 1282499 | 1282807 | + | NZ_CP011366.1 | Salinicoccus halodurans |
| 72 | 1970183 | 1970491 | - | NZ_CP011102.1 | Listeria weihenstephanensis |
| 73 | 1570366 | 1570674 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 74 | 278905 | 279207 | + | NC_000908.2 | Mycoplasma genitalium G37 |
| 75 | 2073240 | 2073548 | - | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 76 | 1892651 | 1892959 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 77 | 1526018 | 1526326 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 78 | 1355503 | 1355811 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 79 | 1589253 | 1589564 | - | NZ_CP016809.1 | Paenibacillus ihbetae |
| 80 | 2804618 | 2804926 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
| 81 | 445548 | 445859 | - | NZ_CP037940.1 | Weissella cryptocerci |
| 82 | 2640447 | 2640758 | - | NC_019897.1 | Thermobacillus composti KWC4 |
| 83 | 662312 | 662611 | - | NZ_LR215050.1 | Acholeplasma hippikon |
| 84 | 3065469 | 3065783 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 85 | 815835 | 816149 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 86 | 1405676 | 1405987 | - | NZ_CP035130.1 | Gudongella oleilytica |
| 87 | 1618041 | 1618355 | - | NZ_LR134439.1 | Erysipelothrix rhusiopathiae |
| 88 | 1722092 | 1722406 | - | NZ_CP060715.1 | Erysipelothrix inopinata |
| 89 | 1104859 | 1105173 | + | NZ_CP034234.1 | Erysipelothrix piscisicarius |
| 90 | 1165471 | 1165782 | + | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 91 | 1646775 | 1647083 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 92 | 928656 | 928970 | + | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 93 | 1318160 | 1318468 | - | NZ_LT632322.1 | Murdochiella vaginalis |
| 94 | 153228 | 153536 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 95 | 912954 | 913268 | + | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 96 | 786979 | 787290 | + | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 97 | 1015356 | 1015664 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 98 | 1265762 | 1266070 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 99 | 1189133 | 1189441 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 100 | 1037041 | 1037352 | + | NZ_CP013213.1 | Erysipelothrix larvae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP024085.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01016.21 | 0.96 | 95 | 351.0 | same-strand | Ribosomal L27 protein |
| 2 | PF04327.14 | 0.85 | 84 | 11 | same-strand | Cysteine protease Prp |
| 3 | PF01018.24 | 0.74 | 73 | 1315.0 | same-strand | GTP1/OBG |
| 4 | PF01926.25 | 0.74 | 73 | 1316.5 | same-strand | 50S ribosome-binding GTPase |
| 5 | PF09269.13 | 0.74 | 73 | 1316.5 | same-strand | Domain of unknown function (DUF1967) |
| 6 | PF02421.20 | 0.65 | 64 | 1334 | same-strand | Ferrous iron transport protein B |
++ More..