Result : Q8EUK2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L32 |
| NCBI Accession ID | BA000026.2 |
| Organism | Mycoplasma penetrans (strain HF-2) |
| Left | 1232950 |
| Right | 1233129 |
| Strand | - |
| Nucleotide Sequence | ATGGCTGTACCACAAAGAAAAGTAACTCACTCTAGAAAAGCTAAAAGAGGGAGTCATTTACATTTATCTATCCCTACTTTAGTTGCTTGTAAACGTTGTGGCAAGAAAATTACACCTCATAGAGTTTGTAATTCTTGCGGATATTACAAAAACAAAAAAGTTCCTCAAATTGAAGCTTAA |
| Sequence | MAVPQRKVTHSRKAKRGSHLHLSIPTLVACKRCGKKITPHRVCNSCGYYKNKKVPQIEA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09115. Profile Description: Ribosomal L32p protein family. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 12466555 |
| Domain | CDD:415589 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q8EUK2 |
| ORF Length (Amino Acid) | 59 |
++ More..
| Conservation Analysis |
No. of Species: 94
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1232950 | 1233129 | - | NC_004432.1 | Mycoplasma penetrans HF-2 |
| 2 | 145981 | 146160 | + | NZ_LR215023.1 | Mycoplasma iowae |
| 3 | 478458 | 478637 | + | NC_007633.1 | Mycoplasma capricolum subsp. capricolum ATCC 27343 |
| 4 | 636194 | 636373 | - | NZ_CP001668.1 | Mycoplasma mycoides subsp. capri str. GM12 |
| 5 | 684832 | 685008 | - | NZ_CP002082.1 | Spiroplasma mirum ATCC 29335 |
| 6 | 712718 | 712894 | - | NZ_CP011855.1 | Spiroplasma atrichopogonis |
| 7 | 825447 | 825623 | - | NZ_CP011856.1 | Spiroplasma eriocheiris |
| 8 | 318214 | 318393 | + | NZ_LS991954.1 | Mycoplasma putrefaciens |
| 9 | 572040 | 572216 | + | NZ_CP024870.1 | Spiroplasma clarkii |
| 10 | 972241 | 972417 | - | NZ_CP013197.1 | Spiroplasma citri |
| 11 | 725564 | 725740 | - | NC_021284.1 | Spiroplasma syrphidicola EA-1 |
| 12 | 719224 | 719400 | - | NC_021280.1 | Spiroplasma chrysopicola DF-1 |
| 13 | 362568 | 362747 | + | NZ_CP025257.1 | Mesoplasma syrphidae |
| 14 | 262547 | 262723 | + | NZ_CP012328.1 | Spiroplasma turonicum |
| 15 | 456012 | 456191 | - | NC_006055.1 | Mesoplasma florum L1 |
| 16 | 503440 | 503619 | - | NZ_CP024964.1 | Entomoplasma melaleucae |
| 17 | 512482 | 512661 | - | NZ_CP024969.1 | Mesoplasma tabanidae |
| 18 | 472750 | 472929 | - | NZ_CP024411.1 | Mesoplasma entomophilum |
| 19 | 501574 | 501753 | - | NZ_CP023173.1 | Mesoplasma chauliocola |
| 20 | 881829 | 882005 | - | NZ_CP038013.1 | Spiroplasma gladiatoris |
| 21 | 548946 | 549122 | + | NZ_CP010899.1 | Spiroplasma kunkelii CR2-3x |
| 22 | 1311921 | 1312097 | - | NZ_CP031088.1 | Spiroplasma phoeniceum P40 |
| 23 | 270245 | 270421 | + | NZ_CP012357.1 | Spiroplasma litorale |
| 24 | 669833 | 670009 | - | NZ_CP025543.1 | Spiroplasma monobiae MQ-1 |
| 25 | 705939 | 706115 | - | NC_021833.1 | Spiroplasma diminutum CUAS-1 |
| 26 | 873994 | 874170 | - | NZ_CP006681.1 | Spiroplasma culicicola AES-1 |
| 27 | 965699 | 965875 | - | NZ_CP025057.1 | Spiroplasma floricola 23-6 |
| 28 | 1038292 | 1038468 | - | NZ_CP043026.1 | Spiroplasma chinense |
| 29 | 932622 | 932798 | - | NZ_CP046276.1 | Spiroplasma tabanidicola |
| 30 | 854423 | 854599 | - | NC_021846.1 | Spiroplasma taiwanense CT-1 |
| 31 | 920906 | 921082 | - | NZ_CP012622.1 | Spiroplasma cantharicola |
| 32 | 137691 | 137873 | + | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 33 | 266975 | 267154 | + | NZ_CP007520.1 | Mycoplasma yeatsii GM274B |
| 34 | 897061 | 897237 | - | NC_022998.1 | Spiroplasma apis B31 |
| 35 | 266151 | 266327 | + | NZ_CP022535.1 | Spiroplasma corruscae |
| 36 | 526699 | 526878 | + | NZ_CP024963.1 | Entomoplasma luminosum |
| 37 | 1094202 | 1094369 | + | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 38 | 457946 | 458116 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 39 | 688870 | 689049 | - | NZ_CP006934.1 | Spiroplasma sabaudiense Ar-1343 |
| 40 | 589671 | 589844 | - | NZ_CP024962.1 | Entomoplasma freundtii |
| 41 | 717763 | 717942 | - | NZ_CP031376.1 | Spiroplasma alleghenense |
| 42 | 2505426 | 2505605 | - | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 43 | 1269641 | 1269823 | + | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 44 | 378939 | 379112 | + | NC_010503.1 | Ureaplasma parvum serovar 3 str. ATCC 27815 |
| 45 | 1693545 | 1693721 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 46 | 458503 | 458697 | + | NZ_LR214951.1 | Mycoplasma neurolyticum |
| 47 | 1513040 | 1513213 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 48 | 821241 | 821417 | - | NZ_CP017015.1 | Spiroplasma helicoides |
| 49 | 42176 | 42349 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 50 | 353687 | 353887 | + | NZ_LR215039.1 | Mycoplasmopsis columboralis |
| 51 | 1030005 | 1030205 | + | NZ_LR215036.1 | Mycoplasmopsis citelli |
| 52 | 794684 | 794884 | - | NC_014921.1 | Mycoplasmopsis fermentans M64 |
| 53 | 1567394 | 1567567 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 54 | 1052967 | 1053140 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 55 | 447621 | 447815 | + | NC_006908.1 | Mycoplasma mobile 163K |
| 56 | 1289509 | 1289682 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 57 | 1079139 | 1079312 | + | NZ_CP011366.1 | Salinicoccus halodurans |
| 58 | 2682283 | 2682459 | - | NC_014624.2 | Eubacterium callanderi |
| 59 | 4290647 | 4290823 | + | NZ_CP029487.1 | Eubacterium maltosivorans |
| 60 | 3094175 | 3094351 | + | NZ_CP019962.1 | Eubacterium limosum |
| 61 | 937743 | 937916 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 62 | 3732798 | 3732971 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 63 | 368154 | 368351 | - | NZ_LR215047.1 | Mycoplasma arthritidis |
| 64 | 1579599 | 1579781 | + | NZ_CP027783.1 | Tetragenococcus osmophilus |
| 65 | 2285039 | 2285215 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 66 | 1219651 | 1219836 | + | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 67 | 1208599 | 1208778 | - | NC_015318.1 | Hippea maritima DSM 10411 |
| 68 | 2125539 | 2125712 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 69 | 1927486 | 1927653 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 70 | 1972044 | 1972217 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 71 | 1269370 | 1269543 | + | NZ_CP012024.1 | Bacillus smithii |
| 72 | 155490 | 155690 | + | NZ_CP005933.1 | Mycoplasmopsis bovis CQ-W70 |
| 73 | 1113778 | 1113951 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 74 | 190971 | 191168 | + | NZ_LS991949.1 | Mycoplasma alkalescens |
| 75 | 356905 | 357102 | - | NZ_CP055143.1 | Mycoplasma hominis |
| 76 | 2448286 | 2448468 | + | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 77 | 862661 | 862861 | + | NZ_LR215037.1 | Mycoplasmopsis maculosa |
| 78 | 323450 | 323653 | - | NZ_LR215032.1 | Mycoplasmopsis gallopavonis |
| 79 | 769572 | 769763 | - | NZ_CP041664.1 | Mycoplasma anserisalpingitidis |
| 80 | 702296 | 702487 | - | NZ_CP030141.1 | Mycoplasmopsis anatis |
| 81 | 815410 | 815601 | - | NC_015387.1 | Marinithermus hydrothermalis DSM 14884 |
| 82 | 1402224 | 1402421 | + | NC_014761.1 | Oceanithermus profundus DSM 14977 |
| 83 | 142620 | 142817 | - | NZ_AP014657.1 | Mycoplasmopsis arginini |
| 84 | 803030 | 803233 | - | NZ_LR215024.1 | Mycoplasmopsis glycophila |
| 85 | 1519180 | 1519329 | + | NZ_CP040463.1 | Caminibacter mediatlanticus TB-2 |
| 86 | 603605 | 603802 | + | NZ_AP014631.1 | Mycoplasma canadense |
| 87 | 539120 | 539320 | + | NZ_AP018940.1 | Mycoplasmopsis californica |
| 88 | 460497 | 460670 | + | NC_000908.2 | Mycoplasma genitalium G37 |
| 89 | 528961 | 529158 | + | NZ_CP033058.2 | Mycoplasma phocicerebrale |
| 90 | 104698 | 104895 | - | NZ_CP030140.1 | Mycoplasma anseris |
| 91 | 689052 | 689252 | + | NZ_LR214970.1 | Mycoplasmopsis bovigenitalium |
| 92 | 1735054 | 1735227 | - | NC_014654.1 | Halanaerobium hydrogeniformans |
| 93 | 868472 | 868645 | + | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 94 | 1425027 | 1425194 | - | NC_019978.1 | Halobacteroides halobius DSM 5150 |
++ More..