Result : Q8ER66
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0298 protein OB1449 |
| NCBI Accession ID | BA000028.3 |
| Organism | Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831) |
| Left | 1487584 |
| Right | 1487859 |
| Strand | + |
| Nucleotide Sequence | ATGAGAGTAAACAGACAAGGAATCATTGTCTGGTTTCAGCATATGAAAAACATAAAACAATTAAGAAAACACGGCAATGTTATTTATGCTTCTAAAACAAAGCGCTATGCTGTGATTTATGTGAATCAGGACGAAATGGATGATGTAGAATTAAAAATAATAAATTACCCTTTTGTATCTAAAGTGGAACGATCTCAAAAACCATTTGTCCGAACGGATTATGAAAATGCGAAACCAGATAAAGCAAAACAATATGATTATAAAATGGGAATATAG |
| Sequence | MRVNRQGIIVWFQHMKNIKQLRKHGNVIYASKTKRYAVIYVNQDEMDDVELKIINYPFVSKVERSQKPFVRTDYENAKPDKAKQYDYKMGI |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23792. Profile Description: Uncharacterized protein conserved in bacteria (DUF2129). hypothetical protein; Provisional |
| Pubmed ID | 12235376 |
| Domain | CDD:420011 |
| Functional Category | Others |
| Uniprot ID | Q8ER66 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 35
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1487584 | 1487859 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 2 | 2715819 | 2716094 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 3 | 3369297 | 3369572 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 4 | 4004674 | 4004949 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 5 | 1702882 | 1703163 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 6 | 1466415 | 1466690 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 7 | 2185238 | 2185513 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 8 | 279456 | 279731 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 9 | 1592806 | 1593081 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 10 | 2516093 | 2516326 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 11 | 1848657 | 1848890 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 12 | 1178208 | 1178483 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 13 | 1650495 | 1650719 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 14 | 34138 | 34413 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 15 | 1518180 | 1518455 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 16 | 1261509 | 1261784 | + | NZ_CP012024.1 | Bacillus smithii |
| 17 | 2762085 | 2762318 | - | NZ_LS483476.1 | Lederbergia lentus |
| 18 | 1458853 | 1459128 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 19 | 253301 | 253576 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 20 | 1578696 | 1578971 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 21 | 2669832 | 2670107 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 22 | 5066617 | 5066892 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 23 | 3378165 | 3378437 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 24 | 1651471 | 1651746 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 25 | 4126015 | 4126290 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 26 | 1054064 | 1054339 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 27 | 4085318 | 4085593 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 28 | 2190599 | 2190841 | - | NZ_CP016540.2 | Planococcus versutus |
| 29 | 1952453 | 1952728 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 30 | 2052354 | 2052629 | + | NZ_CP053989.1 | Niallia circulans |
| 31 | 2945701 | 2945973 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 32 | 2482380 | 2482610 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 33 | 949072 | 949329 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 34 | 1476359 | 1476604 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 35 | 1535481 | 1535726 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP022437.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00188.28 | 0.6 | 21 | 1484 | same-strand | Cysteine-rich secretory protein family |
| 2 | PF14071.8 | 0.86 | 30 | 1028.0 | same-strand | Putative coat protein |
| 3 | PF14003.8 | 0.71 | 25 | 950 | same-strand | YlbE-like protein |
| 4 | PF06133.13 | 1.0 | 35 | 132 | same-strand | Control of competence regulator ComK, YlbF/YmcA |
| 5 | PF03602.17 | 1.0 | 35 | 916 | same-strand | Conserved hypothetical protein 95 |
| 6 | PF01467.28 | 1.0 | 35 | 1492 | same-strand | Cytidylyltransferase-like |
| 7 | PF07670.16 | 0.69 | 24 | 2112.5 | opposite-strand | Nucleoside recognition |
++ More..