Protein Information |
Information Type | Description |
---|---|
Protein name | UPF0435 protein OB1527 |
NCBI Accession ID | BA000028.3 |
Organism | Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831) |
Left | 1570555 |
Right | 1570776 |
Strand | - |
Nucleotide Sequence | ATGAATCTAGATCAACCAAGCACTGAAAATATGAAATATATATTGGATACACTCGCGGAGGAGCTTCAAATTGTGAATCGATCTATTATGGAAGTGGAAGATTACAACCTTGACAAATATGAAGATCTAAAGATGATGTATGAAATGGTAAAAACCAAAGGGCAGTTAAGCGCATTGGAAAAACAAGCATTCATCCAAGAACTATCAAGCATACGTAAATAA |
Sequence | MNLDQPSTENMKYILDTLAEELQIVNRSIMEVEDYNLDKYEDLKMMYEMVKTKGQLSALEKQAFIQELSSIRK |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl23968. Profile Description: Protein of unknown function (DUF1128). This family consists of several short, hypothetical bacterial proteins of unknown function. |
Pubmed ID | 12235376 |
Domain | CDD:420123 |
Functional Category | Others |
Uniprot ID | Q8ER04 |
ORF Length (Amino Acid) | 73 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1570555 | 1570776 | - | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
2 | 363931 | 364155 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
3 | 3274383 | 3274607 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
4 | 2603652 | 2603876 | + | NZ_CP022437.1 | Virgibacillus necropolis |
5 | 3915526 | 3915747 | + | NZ_CP018622.1 | Virgibacillus dokdonensis |
6 | 2099944 | 2100168 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
7 | 1684879 | 1685100 | - | NZ_CP029797.1 | Paraliobacillus zengyii |
8 | 2428249 | 2428476 | + | NZ_CP020772.1 | Halobacillus mangrovi |
9 | 1547900 | 1548121 | - | NZ_CP041666.1 | Radiobacillus deserti |
10 | 1787407 | 1787631 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02504.17 | 0.9 | 9 | 2866 | opposite-strand | Fatty acid synthesis protein |
2 | PF00698.23 | 1.0 | 10 | 1993.5 | opposite-strand | Acyl transferase domain |
3 | PF13561.8 | 1.0 | 10 | 1253.5 | opposite-strand | Enoyl-(Acyl carrier protein) reductase |
4 | PF00106.27 | 1.0 | 10 | 1253.5 | opposite-strand | short chain dehydrogenase |
5 | PF08659.12 | 1.0 | 10 | 1253.5 | opposite-strand | KR domain |
6 | PF00550.27 | 1.0 | 10 | 968.0 | opposite-strand | Phosphopantetheine attachment site |
7 | PF14622.8 | 1.0 | 10 | 66.5 | opposite-strand | Ribonuclease-III-like |
8 | PF00636.28 | 1.0 | 10 | 66.5 | opposite-strand | Ribonuclease III domain |
9 | PF00035.28 | 1.0 | 10 | 66.5 | opposite-strand | Double-stranded RNA binding motif |
10 | PF06470.15 | 0.9 | 9 | 193 | opposite-strand | SMC proteins Flexible Hinge Domain |
11 | PF13476.8 | 0.8 | 8 | 197.0 | opposite-strand | AAA domain |
12 | PF00448.24 | 0.9 | 9 | 4527.5 | opposite-strand | SRP54-type protein, GTPase domain |
13 | PF02881.21 | 0.9 | 9 | 4527.5 | opposite-strand | SRP54-type protein, helical bundle domain |
14 | PF04297.16 | 0.9 | 9 | 4853 | opposite-strand | Putative helix-turn-helix protein, YlxM / p13 like |
15 | PF02978.21 | 0.9 | 9 | 5196 | opposite-strand | Signal peptide binding domain |
16 | PF00886.21 | 0.8 | 8 | 6778.5 | opposite-strand | Ribosomal protein S16 |