Result : Q8EQG4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0346 protein OB1736 |
| NCBI Accession ID | BA000028.3 |
| Organism | Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831) |
| Left | 1778271 |
| Right | 1778498 |
| Strand | - |
| Nucleotide Sequence | ATGGAACAAACATTCTATCAGTTTTTAATGACCTATCGAGGTAAGCTGGAGAAAGATGATAATTCAGAACTTGCGGAATGGGCATTTCGTAATCATAATTTCCCTAAACATTCCAATACCTACGATGAGATTAGTAATTATTTAGAATGGAATAGCCCATTTCCAAGTGCAACAGTAACCTTTGACTCTTTATGGAATGAATACGAATGGAAAAAAGCAGCTTATTAA |
| Sequence | MEQTFYQFLMTYRGKLEKDDNSELAEWAFRNHNFPKHSNTYDEISNYLEWNSPFPSATVTFDSLWNEYEWKKAAY |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl11485. Profile Description: YozE SAM-like fold. hypothetical protein; Provisional |
| Pubmed ID | 12235376 |
| Domain | CDD:416295 |
| Functional Category | Others |
| Uniprot ID | Q8EQG4 |
| ORF Length (Amino Acid) | 75 |
++ More..
| Conservation Analysis |
No. of Species: 13
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1778271 | 1778498 | - | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 2 | 3677144 | 3677335 | + | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 3 | 2053055 | 2053273 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 4 | 892306 | 892527 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 5 | 1924798 | 1924986 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 6 | 1552498 | 1552689 | - | NZ_CP008876.1 | Terribacillus goriensis |
| 7 | 1810269 | 1810463 | - | NZ_CP041666.1 | Radiobacillus deserti |
| 8 | 2013887 | 2014078 | - | NZ_CP029797.1 | Paraliobacillus zengyii |
| 9 | 2211953 | 2212150 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 10 | 3121767 | 3121961 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
| 11 | 2219658 | 2219852 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 12 | 2358165 | 2358359 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 13 | 1323234 | 1323428 | + | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_004193.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01625.23 | 0.69 | 9 | 2805 | same-strand | Peptide methionine sulfoxide reductase |
| 2 | PF01641.20 | 0.69 | 9 | 2805 | same-strand | SelR domain |
| 3 | PF00902.20 | 0.77 | 10 | 40.5 | same-strand | Sec-independent protein translocase protein (TatC) |
| 4 | PF02416.18 | 0.77 | 10 | 992.5 | same-strand | mttA/Hcf106 family |
| 5 | PF00186.21 | 1.0 | 13 | 1655 | same-strand | Dihydrofolate reductase |
++ More..