Protein Information |
Information Type | Description |
---|---|
Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
NCBI Accession ID | |
Organism | Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831) |
Left | |
Right | |
Strand | |
Nucleotide Sequence | |
Sequence | MRHIKVNVKGQVQGVGFRYFTQQAATENAIVGWVRNEDDGSVLIEAQGEDKNVDAFLNEVEKGPTKFARVQDMEVKELAEDTELTKFEVKY |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
Pubmed ID | 12235376 |
Domain | CDD:412440 |
Functional Category | Others |
Uniprot ID | Q8ELH4 |
ORF Length (Amino Acid) | 91 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3390461 | 3390736 | - | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
2 | 1726875 | 1727147 | - | NZ_CP065993.1 | Leuconostoc pseudomesenteroides |
3 | 817212 | 817487 | - | NZ_CP017996.1 | Companilactobacillus crustorum |
4 | 1558608 | 1558883 | + | NZ_CP017195.1 | Lactococcus paracarnosus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00072.26 | 0.75 | 3 | 2181 | same-strand | Response regulator receiver domain |
2 | PF02518.28 | 0.75 | 3 | 598 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
3 | PF00588.21 | 0.75 | 3 | 1039 | opposite-strand | SpoU rRNA Methylase family |
4 | PF08032.14 | 0.75 | 3 | 1039 | opposite-strand | RNA 2'-O ribose methyltransferase substrate binding |