Result : Q8ELH4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | |
| Organism | Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MRHIKVNVKGQVQGVGFRYFTQQAATENAIVGWVRNEDDGSVLIEAQGEDKNVDAFLNEVEKGPTKFARVQDMEVKELAEDTELTKFEVKY |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | 12235376 |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | Q8ELH4 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3390461 | 3390736 | - | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 2 | 1726875 | 1727147 | - | NZ_CP065993.1 | Leuconostoc pseudomesenteroides |
| 3 | 817212 | 817487 | - | NZ_CP017996.1 | Companilactobacillus crustorum |
| 4 | 1558608 | 1558883 | + | NZ_CP017195.1 | Lactococcus paracarnosus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP065993.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00072.26 | 0.75 | 3 | 2181 | same-strand | Response regulator receiver domain |
| 2 | PF02518.28 | 0.75 | 3 | 598 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 3 | PF00588.21 | 0.75 | 3 | 1039 | opposite-strand | SpoU rRNA Methylase family |
| 4 | PF08032.14 | 0.75 | 3 | 1039 | opposite-strand | RNA 2'-O ribose methyltransferase substrate binding |
++ More..