Protein Information |
Information Type | Description |
---|---|
Protein name | Antitoxin HipB |
NCBI Accession ID | AE014299.2 |
Organism | Shewanella oneidensis (strain MR-1) |
Left | 723068 |
Right | 723304 |
Strand | + |
Nucleotide Sequence | ATGGCATCACCGTTAAATCAACAATCCCTCGGCTTGTTAATTAAAGAACGCAGGAAAAGTGCTGCTCTTACTCAAGACGTGGCGGCCATGCTGTGCGGCGTAACCAAAAAAACGCTGATCCGAGTTGAAAAGGGCGAGGATGTTTATATCTCAACCGTATTCAAAATCCTTGATGGTCTGGGGATTGATATCGTTTCGGCTCAAACCAGCGACACCGAAACTAACGGCTGGTATTAA |
Sequence | MASPLNQQSLGLLIKERRKSAALTQDVAAMLCGVTKKTLIRVEKGEDVYISTVFKILDGLGIDIVSAQTSDTETNGWY |
Source of smORF | Swiss-Prot |
Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Neutralizes the toxic effect of cognate toxin HipA; overexpression in wild-type or a hipAB deletion temporarily inhibits cell growth. Binds operator DNA; in the ternary phosphoserine-HipA-HipB-DNA complex the DNA is bent about 125 degrees. {ECO:0000269|Pubmed:25056321}. |
Pubmed ID | 12368813 25056321 |
Domain | CDD:419869 |
Functional Category | Antitoxin_type_2_and_DNA-binding |
Uniprot ID | Q8EIX4 |
ORF Length (Amino Acid) | 78 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 820379 | 820615 | + | NC_016901.1 | Shewanella baltica OS678 |
2 | 4645875 | 4646111 | - | NZ_CP034015.1 | Shewanella livingstonensis |
3 | 4196785 | 4197021 | - | NZ_CP041036.1 | Shewanella polaris |
4 | 498241 | 498450 | + | NC_007954.1 | Shewanella denitrificans OS217 |
5 | 535900 | 536136 | + | NC_009092.1 | Shewanella loihica PV-4 |
6 | 4334985 | 4335221 | - | NC_008345.1 | Shewanella frigidimarina NCIMB 400 |
7 | 504262 | 504498 | + | NZ_CP022272.1 | Shewanella marisflavi |
8 | 5540226 | 5540474 | + | NC_010506.1 | Shewanella woodyi ATCC 51908 |
9 | 495388 | 495636 | - | NC_010334.1 | Shewanella halifaxensis HAW-EB4 |
10 | 3008140 | 3008388 | - | NZ_CP044399.1 | Moritella marina ATCC 15381 |
11 | 2091799 | 2092047 | - | NZ_LS483250.1 | Moritella yayanosii |
12 | 441134 | 441382 | - | NC_009831.1 | Shewanella sediminis HAW-EB3 |
13 | 1515229 | 1515507 | - | NZ_AP022188.1 | Aeromonas media |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF07804.14 | 0.69 | 9 | -6.5 | same-strand | HipA-like C-terminal domain |
2 | PF13657.8 | 0.62 | 8 | -13 | same-strand | HipA N-terminal domain |