Result : Q8EIV3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0251 protein SO_0727 |
| NCBI Accession ID | AE014299.2 |
| Organism | Shewanella oneidensis (strain MR-1) |
| Left | 742568 |
| Right | 742864 |
| Strand | + |
| Nucleotide Sequence | ATGCCAAGACCCAAAAAATGCCGTCAATTATCGAGTTGTGTGCCCTGTAGCCTGTTTAAACCTAATGGCATACCGGCGGCCAACTTATCCCAAATACTATTGGCTGCCGACGAGTTTGAAGCCTTAGAGCTTGGTGATGTGCAGCGTCTTAGTCAGCTTGAGGCCGCAGCGCAAATGGGGATCTCGAGGCAAACCTTTGGTTATCTCCTCGCCAGTGCTCGCCAAAAAGTGGCGACCGCCATTACTCAAGGGTTAGTGCTGAAATTACCGACTCCAAATGATAAGGACCCAATATGA |
| Sequence | MPRPKKCRQLSSCVPCSLFKPNGIPAANLSQILLAADEFEALELGDVQRLSQLEAAAQMGISRQTFGYLLASARQKVATAITQGLVLKLPTPNDKDPI |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl22854. Profile Description: N/A. YdaS_antitoxin is a family of putative bacterial antitoxins, neutralising the toxin YdaT, family pfam06254.**The ORF matches to the profile of cl22867. Profile Description: N/A. Region 4 of sigma-70 like sigma-factors are involved in binding to the -35 promoter element via a helix-turn-helix motif. |
| Pubmed ID | 12368813 |
| Domain | CDD:419869,CDD:419874 |
| Functional Category | Others |
| Uniprot ID | Q8EIV3 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 21
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 830958 | 831254 | + | NC_016901.1 | Shewanella baltica OS678 |
| 2 | 4521232 | 4521522 | - | NC_010334.1 | Shewanella halifaxensis HAW-EB4 |
| 3 | 527406 | 527690 | + | NZ_CP022272.1 | Shewanella marisflavi |
| 4 | 4428195 | 4428485 | - | NC_009901.1 | Shewanella pealeana ATCC 700345 |
| 5 | 4781546 | 4781836 | + | NC_009831.1 | Shewanella sediminis HAW-EB3 |
| 6 | 560444 | 560728 | + | NC_009092.1 | Shewanella loihica PV-4 |
| 7 | 626898 | 627200 | + | NC_011566.1 | Shewanella piezotolerans WP3 |
| 8 | 4060704 | 4060994 | - | NZ_CP046378.1 | Shewanella algae |
| 9 | 3515119 | 3515409 | - | NC_014541.1 | Ferrimonas balearica DSM 9799 |
| 10 | 284728 | 285030 | + | NZ_CP044068.1 | Vibrio vulnificus |
| 11 | 1474415 | 1474726 | + | NZ_LT960612.1 | Vibrio tapetis subsp. tapetis |
| 12 | 1083380 | 1083691 | + | NZ_CP016415.1 | Vibrio scophthalmi |
| 13 | 488323 | 488616 | + | NZ_CP071325.1 | Photobacterium ganghwense |
| 14 | 361911 | 362219 | - | NZ_CP051883.1 | Aeromonas salmonicida |
| 15 | 920712 | 920981 | + | NZ_AP014636.1 | Vibrio tritonius |
| 16 | 1764431 | 1764709 | - | NZ_CP016043.1 | Edwardsiella hoshinae |
| 17 | 1322676 | 1322951 | + | NZ_AP019652.1 | Vibrio taketomensis |
| 18 | 1458554 | 1458829 | + | NZ_AP019658.1 | Vibrio ponticus |
| 19 | 2840072 | 2840350 | - | NZ_CP065150.1 | Vibrio kanaloae |
| 20 | 1864600 | 1864878 | + | NC_011753.2 | Vibrio atlanticus |
| 21 | 1913277 | 1913555 | + | NZ_CP039700.1 | Vibrio cyclitrophicus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_016901.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02579.19 | 0.95 | 20 | 10.0 | same-strand | Dinitrogenase iron-molybdenum cofactor |
++ More..