Result : A9ETE3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L23 |
| NCBI Accession ID | AM746676.1 |
| Organism | Sorangium cellulosum (strain So ce56) (Polyangium cellulosum (strain So ce56)) |
| Left | 1195263 |
| Right | 1195559 |
| Strand | + |
| Nucleotide Sequence | ATGCAGCCCGAGCAGATCATCCGCCGGCCAATCATCCTCACGGAGAAGTCGAGCCGGCTCCGCGACCAAGGCAACAAGGTCATCTTTGAGGTCCGCCGCGAGGCGAACAAGATCCAGATCAAGGACGCCATCCAGACGCTCTTCAAGGTGGGCGTCGTGGACGTCAACACGCTGATCATGCGCGGCAAGGACAAGCGCATGGGGCGCGGCTACGCGAAGCTGCGCAATTGGAAGAAGGCGATCGTCACCCTCAAGGAGGGTGACGAGATCCAGTTCTTCGACGAGAAGGCGGAATAG |
| Sequence | MQPEQIIRRPIILTEKSSRLRDQGNKVIFEVRREANKIQIKDAIQTLFKVGVVDVNTLIMRGKDKRMGRGYAKLRNWKKAIVTLKEGDEIQFFDEKAE |
| Source of smORF | Swiss-Prot |
| Function | One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome. {ECO:0000255|HAMAP-Rule:MF_01369}. |
| Pubmed ID | 17965706 |
| Domain | CDD:412311 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | A9ETE3 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 97
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1195263 | 1195559 | + | NC_010162.1 | Sorangium cellulosum So ce56 |
| 2 | 2485419 | 2485724 | + | NZ_CP012159.1 | Chondromyces crocatus |
| 3 | 9028635 | 9028931 | - | NZ_CP016211.1 | Minicystis rosea |
| 4 | 337395 | 337694 | - | NZ_CP012333.1 | Labilithrix luteola |
| 5 | 3127624 | 3127908 | - | NC_002939.5 | Geobacter sulfurreducens PCA |
| 6 | 701595 | 701879 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
| 7 | 9060813 | 9061103 | - | NZ_CP011125.1 | Sandaracinus amylolyticus |
| 8 | 181785 | 182069 | + | NZ_CP018258.1 | Dehalogenimonas formicexedens |
| 9 | 6074945 | 6075235 | + | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 10 | 699011 | 699307 | + | NC_016148.1 | Thermovirga lienii DSM 17291 |
| 11 | 3111022 | 3111309 | - | NZ_CP010802.1 | Desulfuromonas soudanensis |
| 12 | 1918671 | 1918964 | + | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 13 | 1076058 | 1076342 | - | NC_014314.1 | Dehalogenimonas lykanthroporepellens BL-DC-9 |
| 14 | 666584 | 666880 | + | NC_014011.1 | Aminobacterium colombiense DSM 12261 |
| 15 | 1456642 | 1456884 | - | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 16 | 650689 | 650979 | - | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
| 17 | 1223454 | 1223729 | - | NC_013522.1 | Thermanaerovibrio acidaminovorans DSM 6589 |
| 18 | 1550805 | 1551092 | + | NZ_CP009498.1 | Endomicrobium proavitum |
| 19 | 374119 | 374403 | + | NC_014836.1 | Desulfurispirillum indicum S5 |
| 20 | 2273561 | 2273830 | + | NC_011891.1 | Anaeromyxobacter dehalogenans 2CP-1 |
| 21 | 2700084 | 2700371 | - | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 22 | 2345291 | 2345548 | - | NZ_CP012332.1 | Vulgatibacter incomptus |
| 23 | 1867299 | 1867595 | + | NZ_CP042829.1 | Tepidiforma bonchosmolovskayae |
| 24 | 2775225 | 2775512 | - | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 25 | 5223954 | 5224238 | - | NC_009767.1 | Roseiflexus castenholzii DSM 13941 |
| 26 | 1148191 | 1148445 | + | NZ_CP011801.1 | Nitrospira moscoviensis |
| 27 | 471240 | 471536 | + | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 28 | 2496256 | 2496546 | - | NZ_CP017237.1 | Moorella thermoacetica |
| 29 | 87625 | 87927 | + | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 30 | 3273631 | 3273915 | - | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 31 | 2071902 | 2072189 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 32 | 944135 | 944374 | - | NC_011959.1 | Thermomicrobium roseum DSM 5159 |
| 33 | 2285755 | 2286045 | - | NC_015520.1 | Mahella australiensis 50-1 BON |
| 34 | 961355 | 961654 | + | NZ_CP014159.1 | Aerococcus christensenii |
| 35 | 974944 | 975234 | + | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 36 | 48694 | 48975 | + | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 37 | 1554249 | 1554539 | - | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 38 | 1693289 | 1693543 | + | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 39 | 173125 | 173394 | + | NZ_LN824141.1 | Defluviitoga tunisiensis |
| 40 | 938274 | 938516 | + | NZ_CP067016.1 | Anaerococcus obesiensis |
| 41 | 322973 | 323215 | + | NZ_CP066014.1 | Anaerococcus vaginalis |
| 42 | 1216012 | 1216302 | - | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 43 | 1813024 | 1813314 | - | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 44 | 1003635 | 1003925 | + | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 45 | 2403800 | 2404090 | - | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 46 | 1038851 | 1039141 | + | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 47 | 1146215 | 1146505 | + | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 48 | 1819299 | 1819589 | - | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 49 | 2422864 | 2423145 | - | NZ_CP021255.1 | Desulfobulbus oralis |
| 50 | 220535 | 220774 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 51 | 728698 | 728937 | - | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 52 | 405063 | 405308 | + | NZ_CP048436.1 | Flavonifractor plautii |
| 53 | 747802 | 748041 | + | NC_015682.1 | Thermodesulfobacterium geofontis OPF15 |
| 54 | 2219841 | 2220131 | - | NC_012982.1 | Hirschia baltica ATCC 49814 |
| 55 | 984171 | 984443 | + | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 56 | 129110 | 129400 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 57 | 828432 | 828728 | - | NC_010003.1 | Petrotoga mobilis SJ95 |
| 58 | 1242136 | 1242450 | - | NZ_CP037948.1 | Qipengyuania sediminis |
| 59 | 147933 | 148217 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 60 | 1134479 | 1134775 | + | NZ_CP016757.1 | Cloacibacillus porcorum |
| 61 | 138245 | 138535 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 62 | 1628259 | 1628549 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 63 | 529771 | 530040 | + | NZ_CP011805.1 | Pelagerythrobacter marensis |
| 64 | 1403454 | 1403693 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 65 | 1318110 | 1318412 | + | NC_023151.1 | Thermotoga maritima MSB8 |
| 66 | 293904 | 294155 | + | NZ_CP026923.1 | Pontimonas salivibrio |
| 67 | 1327527 | 1327829 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 68 | 1303923 | 1304225 | + | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 69 | 3439202 | 3439471 | + | NZ_CP049037.1 | Pseudohalocynthiibacter aestuariivivens |
| 70 | 3250484 | 3250753 | + | NC_014664.1 | Rhodomicrobium vannielii ATCC 17100 |
| 71 | 1933396 | 1933665 | - | NZ_CP059896.1 | Ciceribacter thiooxidans |
| 72 | 6594835 | 6595104 | - | NZ_CP029550.1 | Methylobacterium durans |
| 73 | 1664700 | 1664987 | + | NZ_CP049889.1 | Jeotgalibaca porci |
| 74 | 2190992 | 2191261 | - | NZ_CP019937.1 | Ketogulonicigenium robustum |
| 75 | 1491052 | 1491300 | - | NZ_CP014334.1 | Fervidobacterium islandicum |
| 76 | 4436264 | 4436533 | + | NZ_CP016616.1 | Microvirga ossetica |
| 77 | 864506 | 864775 | - | NZ_CP015093.1 | Salipiger abyssi |
| 78 | 503574 | 503858 | + | NZ_CP016843.1 | Carnobacterium divergens |
| 79 | 2468214 | 2468483 | - | NZ_CP045423.1 | Microvirga thermotolerans |
| 80 | 3264253 | 3264522 | - | NZ_CP049241.1 | Rhizobium pseudoryzae |
| 81 | 4859486 | 4859737 | + | NZ_LR134501.1 | Nocardiopsis dassonvillei |
| 82 | 1433112 | 1433366 | + | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 83 | 1603129 | 1603383 | + | NZ_CP027850.1 | Caulobacter segnis |
| 84 | 990059 | 990364 | + | NZ_CP007389.1 | Thermosipho melanesiensis |
| 85 | 2948416 | 2948679 | + | NC_009719.1 | Parvibaculum lavamentivorans DS-1 |
| 86 | 2967914 | 2968168 | + | NZ_CP026100.1 | Caulobacter flavus |
| 87 | 212713 | 212982 | - | NZ_CP034179.1 | Caenibius tardaugens NBRC 16725 |
| 88 | 1489713 | 1490015 | + | NC_014375.1 | Brevundimonas subvibrioides ATCC 15264 |
| 89 | 2051755 | 2052009 | - | NZ_LR588407.1 | Brevundimonas vancanneytii |
| 90 | 1877751 | 1878005 | + | NZ_CP024201.1 | Caulobacter mirabilis |
| 91 | 1965972 | 1966268 | + | NZ_CP015367.1 | Methylobacterium phyllosphaerae |
| 92 | 2678567 | 2678863 | + | NZ_CP003811.1 | Methylobacterium oryzae CBMB20 |
| 93 | 2015822 | 2016076 | + | NC_011894.1 | Methylobacterium nodulans ORS 2060 |
| 94 | 1252676 | 1252972 | + | NC_013235.1 | Nakamurella multipartita DSM 44233 |
| 95 | 1421030 | 1421332 | + | NC_011144.1 | Phenylobacterium zucineum HLK1 |
| 96 | 2357129 | 2357425 | + | NC_010505.1 | Methylobacterium radiotolerans JCM 2831 |
| 97 | 5606004 | 5606258 | - | NZ_CP043538.1 | Methylobacterium mesophilicum SR1.6/6 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002939.5
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00009.29 | 0.73 | 71 | 2227 | same-strand | Elongation factor Tu GTP binding domain |
| 2 | PF03764.20 | 0.67 | 65 | 2978 | same-strand | Elongation factor G, domain IV |
| 3 | PF14492.8 | 0.67 | 65 | 2978 | same-strand | Elongation Factor G, domain III |
| 4 | PF00679.26 | 0.67 | 65 | 2978 | same-strand | Elongation factor G C-terminus |
| 5 | PF03144.27 | 0.73 | 71 | 2227 | same-strand | Elongation factor Tu domain 2 |
| 6 | PF03143.19 | 0.7 | 68 | 1777.0 | same-strand | Elongation factor Tu C-terminal domain |
| 7 | PF00338.24 | 0.98 | 95 | 1343 | same-strand | Ribosomal protein S10p/S20e |
| 8 | PF00573.24 | 1.0 | 97 | 2 | same-strand | Ribosomal protein L4/L1 family |
| 9 | PF03947.20 | 0.99 | 96 | 19.5 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 10 | PF00181.25 | 0.99 | 96 | 19.5 | same-strand | Ribosomal Proteins L2, RNA binding domain |
| 11 | PF00203.23 | 0.99 | 96 | 869.0 | same-strand | Ribosomal protein S19 |
| 12 | PF01926.25 | 0.64 | 62 | 1818.5 | same-strand | 50S ribosome-binding GTPase |
| 13 | PF00252.20 | 0.92 | 89 | 2282 | same-strand | Ribosomal protein L16p/L10e |
| 14 | PF00189.22 | 0.94 | 91 | 1547 | same-strand | Ribosomal protein S3, C-terminal domain |
| 15 | PF07650.19 | 0.94 | 91 | 1547 | same-strand | KH domain |
| 16 | PF00237.21 | 0.94 | 91 | 1169 | same-strand | Ribosomal protein L22p/L17e |
++ More..