Protein Information |
Information Type | Description |
---|---|
Protein name | ESAT-6-like protein SAG0230 |
NCBI Accession ID | AE009948.1 |
Organism | Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) |
Left | 240870 |
Right | 241160 |
Strand | + |
Nucleotide Sequence | ATGTCACAAATTAAACTAACACCTGAAGAACTCCGTATTTCAGCACAAAAATATACAACAGGATCACAATCAATTACAGATGTGTTAACAGTTTTGACTCAAGAACAAGCTGTTATTGATGAAAATTGGGATGGTACAGCATTTGATAGCTTTGAAGCCCAATTCAATGAATTATCTCCAAAAATCACACAATTTGCACAATTATTAGAAGATATAAATCAACAATTATTGAAAGTTGCGGATGTTGTCGAACAAACAGACTCAGATATTGCCTCACAAATTAATAAATAA |
Sequence | MSQIKLTPEELRISAQKYTTGSQSITDVLTVLTQEQAVIDENWDGTAFDSFEAQFNELSPKITQFAQLLEDINQQLLKVADVVEQTDSDIASQINK |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl02005. Profile Description: Proteins of 100 residues with WXG. T7SS_ESX-EspC is a family of exported virulence proteins from largely Acinetobacteria and a few Fimicutes, Gram-positive bacteria. It is exported in conjunction with EspA as an interacting pair.ED F8ADQ6.1/227-313; F8ADQ6.1/227-313; |
Pubmed ID | 12200547 24586681 |
Domain | CDD:413154 |
Functional Category | Others |
Uniprot ID | Q8E1X1 |
ORF Length (Amino Acid) | 96 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 239111 | 239401 | + | NZ_LR134512.1 | Streptococcus agalactiae |
2 | 1030553 | 1030843 | - | NZ_LR134512.1 | Streptococcus agalactiae |
3 | 1030096 | 1030386 | - | NZ_LR134512.1 | Streptococcus agalactiae |
4 | 285377 | 285667 | + | NZ_LS483436.1 | Streptococcus intermedius |
5 | 59147 | 59434 | + | NZ_LR594049.1 | Streptococcus gordonii |
6 | 2120507 | 2120797 | - | NZ_CP031733.1 | Streptococcus chenjunshii |
7 | 2277934 | 2278224 | - | NZ_CP031733.1 | Streptococcus chenjunshii |
8 | 1104723 | 1105019 | - | NZ_LS483343.1 | Streptococcus ferus |
9 | 1327750 | 1328043 | + | NZ_CP054015.1 | Streptococcus gallolyticus |
10 | 1822097 | 1822387 | - | NZ_CP014699.1 | Streptococcus pantholopis |
11 | 751278 | 751574 | + | NZ_CP025536.1 | Streptococcus pluranimalium |
12 | 2166281 | 2166574 | - | NZ_CP016843.1 | Carnobacterium divergens |
13 | 853175 | 853465 | + | NZ_CP045007.1 | Latilactobacillus graminis |
14 | 76379 | 76681 | + | NZ_CP021876.1 | Enterococcus wangshanyuanii |
15 | 2468728 | 2469030 | + | NZ_CP021874.1 | Enterococcus wangshanyuanii |
16 | 2173169 | 2173471 | + | NZ_CP021874.1 | Enterococcus wangshanyuanii |
17 | 2585066 | 2585368 | + | NZ_CP021874.1 | Enterococcus wangshanyuanii |
18 | 2444460 | 2444762 | - | NZ_CP021874.1 | Enterococcus wangshanyuanii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF10140.11 | 0.91 | 10 | 4036.5 | same-strand | WXG100 protein secretion system (Wss), protein YukC |
2 | PF08817.12 | 0.82 | 9 | 3802 | same-strand | WXG100 protein secretion system (Wss), protein YukD |
3 | PF01580.20 | 0.82 | 9 | 5200.0 | same-strand | FtsK/SpoIIIE family |
4 | PF13401.8 | 0.73 | 8 | 5254 | same-strand | AAA domain |