Result : Q8DZV1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0223 protein SAG0995 |
| NCBI Accession ID | AE009948.1 |
| Organism | Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) |
| Left | 1004440 |
| Right | 1004721 |
| Strand | - |
| Nucleotide Sequence | ATGATTAGTAGTAATTATAGTTATCCTCTTGATCCTTCATGGAATACGGAAGATATTACTAAGGTACTTCGCTTTTTAAATCAAGTTGAACACGCCTATGAAAATAGTATTAAAGTTGATGATTTGCTAGATAGCTATAAAGAATTTAAAAAAGTTGTTAAATCCAAGGCGCAGGAAAAACAAATTGACCGTGAATTCCAGAGAACTAGCGGTTATTCCACTTATCAAGCTGTTAAAGCAGCACAACAACAAGCGAAAGGATTTATTTCACTTGGACGCTAA |
| Sequence | MISSNYSYPLDPSWNTEDITKVLRFLNQVEHAYENSIKVDDLLDSYKEFKKVVKSKAQEKQIDREFQRTSGYSTYQAVKAAQQQAKGFISLGR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23825. Profile Description: Uncharacterized protein family (UPF0223). hypothetical protein; Provisional |
| Pubmed ID | 12200547 |
| Domain | CDD:420035 |
| Functional Category | Others |
| Uniprot ID | Q8DZV1 |
| ORF Length (Amino Acid) | 93 |
++ More..
| Conservation Analysis |
No. of Species: 46
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 990761 | 991042 | - | NZ_LR134512.1 | Streptococcus agalactiae |
| 2 | 1310038 | 1310316 | - | NZ_CP031733.1 | Streptococcus chenjunshii |
| 3 | 1066102 | 1066380 | - | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 4 | 1179649 | 1179927 | - | NZ_LR594046.1 | Streptococcus dysgalactiae |
| 5 | 1705772 | 1706050 | - | NZ_LR134293.1 | Streptococcus canis |
| 6 | 1001121 | 1001402 | + | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 7 | 1030572 | 1030850 | - | NZ_CP014699.1 | Streptococcus pantholopis |
| 8 | 1767795 | 1768073 | + | NZ_CP015196.1 | Streptococcus marmotae |
| 9 | 1851141 | 1851419 | - | NZ_CP043405.1 | Streptococcus ratti |
| 10 | 899270 | 899548 | + | NZ_LR594050.1 | Streptococcus porcinus |
| 11 | 923554 | 923832 | - | NZ_CP010450.1 | Streptococcus pyogenes |
| 12 | 2018870 | 2019118 | - | NZ_CP054015.1 | Streptococcus gallolyticus |
| 13 | 912190 | 912438 | - | NZ_LS483403.1 | Streptococcus lutetiensis |
| 14 | 1290356 | 1290634 | - | NZ_CP029491.1 | Streptococcus sobrinus |
| 15 | 277332 | 277610 | - | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 16 | 1393448 | 1393726 | + | NZ_CP022680.1 | Streptococcus respiraculi |
| 17 | 846345 | 846623 | + | NZ_LS483343.1 | Streptococcus ferus |
| 18 | 539547 | 539825 | + | NZ_CP013237.1 | Streptococcus mutans |
| 19 | 1122435 | 1122683 | - | NZ_CP039457.1 | Streptococcus pasteurianus |
| 20 | 496746 | 497027 | + | NZ_CP014835.1 | Streptococcus halotolerans |
| 21 | 824159 | 824437 | + | NZ_AP018400.1 | Streptococcus ruminantium |
| 22 | 1069554 | 1069832 | - | NC_012924.1 | Streptococcus suis SC84 |
| 23 | 949788 | 950069 | + | NZ_LR134275.1 | Streptococcus vestibularis |
| 24 | 1083080 | 1083358 | + | NZ_LR594049.1 | Streptococcus gordonii |
| 25 | 1074699 | 1074983 | - | NZ_CP034543.1 | Streptococcus periodonticum |
| 26 | 1190912 | 1191196 | - | NZ_LS483436.1 | Streptococcus intermedius |
| 27 | 1581109 | 1581387 | + | NZ_CP016953.1 | Streptococcus himalayensis |
| 28 | 991482 | 991760 | - | NZ_LS483383.1 | Streptococcus cristatus ATCC 51100 |
| 29 | 1334098 | 1334346 | - | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 30 | 1125407 | 1125691 | - | NZ_CP012805.1 | Streptococcus anginosus |
| 31 | 1091981 | 1092229 | - | NZ_CP032621.1 | Streptococcus gwangjuense |
| 32 | 1040076 | 1040357 | - | NZ_CP025536.1 | Streptococcus pluranimalium |
| 33 | 1217486 | 1217764 | - | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 34 | 598307 | 598585 | + | NZ_LT906439.1 | Streptococcus merionis |
| 35 | 1985648 | 1985878 | - | NZ_CP065637.1 | Lactococcus garvieae |
| 36 | 643065 | 643346 | + | NZ_CP070872.1 | Lactococcus taiwanensis |
| 37 | 16006 | 16281 | + | NZ_CP032627.1 | Lactococcus allomyrinae |
| 38 | 495694 | 495924 | + | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 39 | 673596 | 673883 | + | NZ_CP045530.1 | Limosilactobacillus pontis |
| 40 | 713805 | 714098 | + | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 41 | 2750218 | 2750499 | + | NZ_CP037940.1 | Weissella cryptocerci |
| 42 | 1898695 | 1898955 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 43 | 1750174 | 1750404 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 44 | 123478 | 123759 | - | NZ_CP012294.1 | Pediococcus damnosus |
| 45 | 576991 | 577278 | + | NZ_CP023501.1 | Weissella paramesenteroides |
| 46 | 689172 | 689399 | + | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134512.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00528.24 | 0.7 | 32 | 3223 | same-strand | Binding-protein-dependent transport system inner membrane component |
| 2 | PF12849.9 | 0.67 | 31 | 2224 | same-strand | PBP superfamily domain |
| 3 | PF12727.9 | 0.67 | 31 | 2224 | same-strand | PBP superfamily domain |
| 4 | PF01189.19 | 0.61 | 28 | 771.5 | same-strand | 16S rRNA methyltransferase RsmB/F |
| 5 | PF17126.7 | 0.61 | 28 | 771.5 | same-strand | RsmF rRNA methyltransferase first C-terminal domain |
| 6 | PF17125.7 | 0.61 | 28 | 771.5 | same-strand | N-terminal domain of 16S rRNA methyltransferase RsmF |
| 7 | PF13636.8 | 0.61 | 28 | 771.5 | same-strand | RNA-binding PUA-like domain of methyltransferase RsmF |
| 8 | PF00459.27 | 0.93 | 43 | -10 | same-strand | Inositol monophosphatase family |
| 9 | PF03960.17 | 0.83 | 38 | 2.0 | same-strand | ArsC family |
| 10 | PF06574.14 | 0.67 | 31 | 504 | same-strand | FAD synthetase |
| 11 | PF01687.19 | 0.67 | 31 | 504 | same-strand | Riboflavin kinase |
| 12 | PF01509.20 | 0.65 | 30 | 1445.5 | same-strand | TruB family pseudouridylate synthase (N terminal domain) |
++ More..